DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment l(2)k09913 and tmem53

DIOPT Version :9

Sequence 1:NP_001286754.1 Gene:l(2)k09913 / 37661 FlyBaseID:FBgn0021979 Length:389 Species:Drosophila melanogaster
Sequence 2:NP_001107322.1 Gene:tmem53 / 100135126 XenbaseID:XB-GENE-1018172 Length:289 Species:Xenopus tropicalis


Alignment Length:291 Identity:63/291 - (21%)
Similarity:108/291 - (37%) Gaps:65/291 - (22%)


- Green bases have known domain annotations that are detailed below.


  Fly   127 KTQVEVDPKTLAFKKPT---------GNPLVLMMAWLMAKQKHLKKYAQIYTEMGFDVVVVHITP 182
            |...|:| .|:.|.:||         ..|:|:::.|...|.::|.||..||...|. .|:.:...
 Frog     5 KADSELD-YTIEFPEPTFQDWQWDREQEPVVILLGWGGCKDQYLTKYGAIYHNKGC-TVIKYTAA 67

  Fly   183 WQLLWPVK--GSQVVAAETIRFLENNKSYE----PIVMHGFSVGAYQLGEIMLQMSRDMDRYGSI 241
            |..::..:  |...:..|..:.||....||    ||:.|.||.|.:.|...::::.:...|...:
 Frog    68 WNAVFVTESLGLSSLREEAKKLLELLFEYEIEKSPILFHVFSNGGFMLYRYIVELLQSHCRLNKL 132

  Fly   242 LDRFVCQVWDSAADITEIPVGVPKSIFPRNERMQSALRNYTLYHLKTFHNQA------------- 293
              ..|..::|||               |.|..:..::|..... |:|..|:|             
 Frog   133 --HVVGTIFDSA---------------PGNRNVIGSVRALDTI-LRTSTNKAFRFLALAAFALMV 179

  Fly   294 ---------TIHYMRSSQMFHSTLLKA-----PALFFVSDNDPIGPPSSNQSVREDWERANIKVT 344
                     ...|:..:   |...:|.     |.|:..|..|||......:|:.....|..:...
 Frog   180 IILRILLYPVTRYVHEN---HYDAMKKDPSRWPQLYLYSRADPIISYLDVESIIAARRRRCLPTE 241

  Fly   345 FKCWERSQHAAHYIRHREEYLQTLFQHLETC 375
            ...:.:|:|.:|:.|..:.|.:|....|..|
 Frog   242 ALDFGKSEHVSHFRRFPQRYSETCTSFLRDC 272

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
l(2)k09913NP_001286754.1 DUF829 146..372 CDD:283384 54/258 (21%)
tmem53NP_001107322.1 DUF829 32..269 CDD:283384 54/258 (21%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D916101at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.010

Return to query results.
Submit another query.