DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment KCNJ10 and Irk2

DIOPT Version :9

Sequence 1:NP_002232.2 Gene:KCNJ10 / 3766 HGNCID:6256 Length:379 Species:Homo sapiens
Sequence 2:NP_001287485.1 Gene:Irk2 / 42770 FlyBaseID:FBgn0039081 Length:454 Species:Drosophila melanogaster


Alignment Length:351 Identity:136/351 - (38%)
Similarity:196/351 - (55%) Gaps:20/351 - (5%)


- Green bases have known domain annotations that are detailed below.


Human    27 RRRVLTKDGRSNVRMEHIADKRFLYLKDLWTTFIDMQWRYKLLLFSATFAGTWFLFGVVWYLVAV 91
            |||.:.|:|..||..:|:..:|..:|:|::||.:|.|||:.||.|:.:|..:|..|.::|:|:..
  Fly    96 RRRAVFKNGDCNVVQKHLQRRRVRFLQDMYTTMVDWQWRWTLLAFALSFILSWLFFALIWWLIIY 160

Human    92 AHGDLLELDPPANH-----TPCVVQVHTLTGAFLFSLESQTTIGYGFRYISEECPLAIVLLIAQL 151
            .||||.|...|.|.     .|||..:...|..||||:|:|.|||||.|..|.|||.||.::..|.
  Fly   161 THGDLEEPHLPENQEESGWAPCVSAIDGFTSCFLFSIETQHTIGYGVRTTSPECPEAIFMMCFQS 225

Human   152 VLTTILEIFITGTFLAKIARPKKRAETIRFSQHAVVASHNGKPCLMIRVANMRKSLLIGCQVTGK 216
            :...:...|:.|...||:.|.|:||:|:.||:|||:...:|...||.||.:||||.:||..|..:
  Fly   226 IYGVMSSAFMAGIVFAKMTRAKQRAQTLLFSKHAVICQRDGTLSLMFRVGDMRKSHIIGAGVRAQ 290

Human   217 LLQTHQTKEGENIRLNQVNVTFQVDTASDSPFLILPLTFYHVVDETSPLKDLPLRSGEGD-FELV 280
            |::|..|||||.:......:....|.:....|.|.|:...|.:||.|||.:|.......| ||:|
  Fly   291 LIRTKSTKEGEVMTQYFTELEIGTDDSGSDLFFIWPMVIEHKIDENSPLYNLNATDMLQDKFEIV 355

Human   281 LILSGTVESTSATCQVRTSYLPEEILWGYEFTPAI----SLSASGKYIADFSLFDQVVKVASP-S 340
            :||.||||||..:.|.|:||:..|||||:.|.|.:    .|.|   |..|::.|::..:|.:| .
  Fly   356 VILEGTVESTGQSTQARSSYINTEILWGHRFDPVVLYNKDLQA---YEIDYARFNETTQVDTPLC 417

Human   341 GLRDSTVRYGDPEKLKLEESLREQAE 366
            ..|:....|      |::|..|..||
  Fly   418 SARELNEIY------KIQEGFRTPAE 437

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
KCNJ10NP_002232.2 IRK 31..172 CDD:395797 56/145 (39%)
Selectivity filter. /evidence=ECO:0000250 128..133 4/4 (100%)
IRK_C 179..354 CDD:407551 67/180 (37%)
Irk2NP_001287485.1 IRK 100..434 CDD:279361 130/342 (38%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG59160
OrthoDB 1 1.010 - - D289862at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR11767
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
44.030

Return to query results.
Submit another query.