DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment twi and MSC

DIOPT Version :9

Sequence 1:NP_001033967.1 Gene:twi / 37655 FlyBaseID:FBgn0003900 Length:490 Species:Drosophila melanogaster
Sequence 2:NP_005089.2 Gene:MSC / 9242 HGNCID:7321 Length:206 Species:Homo sapiens


Alignment Length:215 Identity:61/215 - (28%)
Similarity:90/215 - (41%) Gaps:37/215 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly   244 QQQQSQQLQQQQPHQQSHAQMHFQNAYRQSFEGYEP--ANSLNGSAYSSSDRDDMEYARHNALSS 306
            ::.:.:.||::.|...|.         |....|.|.  |:..:.|:....|.|..|  ...||.:
Human    10 EEMELRGLQREYPVPASK---------RPPLRGVERSYASPSDNSSAEEEDPDGEE--ERCALGT 63

  Fly   307 VSDLNGGVMSPACLADDGSAGSLLDGSDAGGKAFRKPRRRLKRKPSKTEETDEFSNQRVMANVRE 371
            .....|.......:|..|.||    ||..||.  :||      .|:|....:...:||..||.||
Human    64 AGSAEGCKRKRPRVAGGGGAG----GSAGGGG--KKP------LPAKGSAAECKQSQRNAANARE 116

  Fly   372 RQRTQSLNDAFKSLQQIIPTLPSD-KLSKIQTLKLATRYIDFLCRMLSSS--------DISLLKA 427
            |.|.:.|:.||..|:..:|.:|.| ||||:.||:||:.||..|.::|...        .::|...
Human   117 RARMRVLSKAFSRLKTSLPWVPPDTKLSKLDTLRLASSYIAHLRQLLQEDRYENGYVHPVNLTWP 181

  Fly   428 LEAQGSPSAYGSASSLLSAA 447
            ....|.|.   |.:..:|||
Human   182 FVVSGRPD---SDTKEVSAA 198

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
twiNP_001033967.1 HLH 363..413 CDD:278439 25/50 (50%)
MSCNP_005089.2 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..115 31/127 (24%)
Nuclear localization signal. /evidence=ECO:0000255 71..76 0/4 (0%)
bHLH_TS_musculin 105..170 CDD:381546 27/64 (42%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C165149610
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
21.840

Return to query results.
Submit another query.