DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment twi and TWIST1

DIOPT Version :9

Sequence 1:NP_001033967.1 Gene:twi / 37655 FlyBaseID:FBgn0003900 Length:490 Species:Drosophila melanogaster
Sequence 2:NP_000465.1 Gene:TWIST1 / 7291 HGNCID:12428 Length:202 Species:Homo sapiens


Alignment Length:281 Identity:85/281 - (30%)
Similarity:117/281 - (41%) Gaps:84/281 - (29%)


- Green bases have known domain annotations that are detailed below.


  Fly   211 VQSTCTSPQSHFDFPDEELPEHKAQVFLPLYNNQQQQSQQLQQQQPHQQSHAQMHFQNAYRQSFE 275
            :|...:||.|                  |..::.....::..:|||..........:::.|.:..
Human     2 MQDVSSSPVS------------------PADDSLSNSEEEPDRQQPPSGKRGGRKRRSSRRSAGG 48

  Fly   276 GYEPANSLNGSAYSSSDRDDMEYARHNALSSVSDLNGGVMSPACLADDGSAGSLLDGSDAGGKAF 340
            |..|..:..|......:.           .|.:....|..|..|....|:.|.  .||.:||   
Human    49 GAGPGGAAGGGVGGGDEP-----------GSPAQGKRGKKSAGCGGGGGAGGG--GGSSSGG--- 97

  Fly   341 RKPRRRLKRKPSKTEETDEFSNQRVMANVRERQRTQSLNDAFKSLQQIIPTLPSDKLSKIQTLKL 405
                       ...:..:|...|||||||||||||||||:||.:|::||||||||||||||||||
Human    98 -----------GSPQSYEELQTQRVMANVRERQRTQSLNEAFAALRKIIPTLPSDKLSKIQTLKL 151

  Fly   406 ATRYIDFLCRMLSSSDISLLKALEAQGSPSAYGSASSLLSAAANGAEADLKCLRKANGAPIIPPE 470
            |.||||||.::|.|.:      |:::.:..:|                             :..|
Human   152 AARYIDFLYQVLQSDE------LDSKMASCSY-----------------------------VAHE 181

  Fly   471 KLSYLFGVWRMEG----DAQH 487
            :|||.|.||||||    .|.|
Human   182 RLSYAFSVWRMEGAWSMSASH 202

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
twiNP_001033967.1 HLH 363..413 CDD:278439 43/49 (88%)
TWIST1NP_000465.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..105 22/147 (15%)
HLH 109..159 CDD:278439 43/49 (88%)
Sufficient for transactivation activity. /evidence=ECO:0000250 161..191 10/64 (16%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C165149613
Domainoid 1 1.000 90 1.000 Domainoid score I7783
eggNOG 1 0.900 - - E1_KOG4447
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 1 0.950 - 0 Normalized mean entropy S4574
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0001055
OrthoInspector 1 1.000 - - otm41326
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR23349
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R5507
SonicParanoid 1 1.000 - - X1477
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
109.820

Return to query results.
Submit another query.