DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment twi and Atoh8

DIOPT Version :9

Sequence 1:NP_001033967.1 Gene:twi / 37655 FlyBaseID:FBgn0003900 Length:490 Species:Drosophila melanogaster
Sequence 2:NP_722473.1 Gene:Atoh8 / 71093 MGIID:1918343 Length:322 Species:Mus musculus


Alignment Length:253 Identity:59/253 - (23%)
Similarity:93/253 - (36%) Gaps:75/253 - (29%)


- Green bases have known domain annotations that are detailed below.


  Fly   195 LPTTVDEVASAQSCPGVQSTCTSPQSHFDFPDEELPEHKAQVFLPLYNNQQQQSQQLQQQQPHQQ 259
            |||.....||....||      .|::| .|.::.|   :.::.|.....:..||..|......|:
Mouse   123 LPTPPPPPASQSLAPG------DPEAH-SFREQAL---RPRILLCAPPARPTQSAPLAPPAAPQE 177

  Fly   260 SHAQMHFQNAYRQSFEGYEPANSLNGSAYSSSDRDDMEYARHNALSSVSDLNGGVMSPACLADDG 324
            |..:.             .|......|:|||...  :.|..|                    .|.
Mouse   178 SPVRP-------------APPTRPGESSYSSISH--VIYNNH--------------------PDS 207

  Fly   325 SAGSLLDGSDAGGKAFRKPRRRLKRKPSKTEETDEF-SNQRVMANVRERQRTQSLNDAFKSLQQI 388
            ||               .||:|.....:.:.|.... ..:|::||.|||.|..:::.||::|::.
Mouse   208 SA---------------SPRKRPGEATAASTEIKALQQTRRLLANARERTRVHTISAAFEALRKQ 257

  Fly   389 IPTLP-SDKLSKIQTLKLATRYIDFLCRMLS---SSDISLL----------KALEAQG 432
            :|... ..||||:..|::|..||..|.|:..   |:|.|.|          :.|:|:|
Mouse   258 VPCYSYGQKLSKLAILRIACNYILSLARLADLDYSADHSNLSFSECVQRCTRTLQAEG 315

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
twiNP_001033967.1 HLH 363..413 CDD:278439 19/50 (38%)
Atoh8NP_722473.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 77..96
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 101..144 9/27 (33%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 159..221 18/111 (16%)
Basic motif, degenerate. /evidence=ECO:0000255|PROSITE-ProRule:PRU00981 231..244 6/12 (50%)
HLH 232..283 CDD:278439 19/50 (38%)
Helix-loop-helix motif. /evidence=ECO:0000255|PROSITE-ProRule:PRU00981 245..283 12/37 (32%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.