DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment twi and Tcf23

DIOPT Version :9

Sequence 1:NP_001033967.1 Gene:twi / 37655 FlyBaseID:FBgn0003900 Length:490 Species:Drosophila melanogaster
Sequence 2:XP_001067558.2 Gene:Tcf23 / 688600 RGDID:1586500 Length:215 Species:Rattus norvegicus


Alignment Length:114 Identity:36/114 - (31%)
Similarity:47/114 - (41%) Gaps:32/114 - (28%)


- Green bases have known domain annotations that are detailed below.


  Fly   329 LLDGSDAGGKAFRKPRRRLKRKPSKTEETDEFSNQRVMA------------------------NV 369
            ||.|:|       :.|.||.|......:...:||.|:..                        ..
  Rat    23 LLLGTD-------RKRSRLNRTRQDLWDDTSWSNHRLSRVTSAPRRTRARGTAHGRSEASPENAA 80

  Fly   370 RERQRTQSLNDAFKSLQQIIPTLPSD-KLSKIQTLKLATRYIDFLCRML 417
            |||.|.::|..||.:||..:|.:|.| ||||:..|.|||.||..|.|.|
  Rat    81 RERTRVKTLRQAFLALQAALPAVPPDTKLSKLDVLVLATSYIAHLTRTL 129

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
twiNP_001033967.1 HLH 363..413 CDD:278439 23/74 (31%)
Tcf23XP_001067558.2 HLH 80..129 CDD:197674 24/48 (50%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C166343465
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.840

Return to query results.
Submit another query.