DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment twi and Olig1

DIOPT Version :9

Sequence 1:NP_001033967.1 Gene:twi / 37655 FlyBaseID:FBgn0003900 Length:490 Species:Drosophila melanogaster
Sequence 2:NP_068538.2 Gene:Olig1 / 60394 RGDID:621129 Length:261 Species:Rattus norvegicus


Alignment Length:234 Identity:69/234 - (29%)
Similarity:98/234 - (41%) Gaps:59/234 - (25%)


- Green bases have known domain annotations that are detailed below.


  Fly   251 LQQQQPHQ-QSHAQMHFQNAYRQSFEGYEPANSLNGSAYSSSDRDDM-EYARHNALSSVSDLNGG 313
            |:.|:|.. |..|.::....|||      |..|.:.|..|||....: :.||....:.:::..| 
  Rat    18 LRPQRPGDVQLGASLYELVGYRQ------PPISSSSSTSSSSTASLLPKPAREKPEAPLAEPRG- 75

  Fly   314 VMSPACLADDGSAGSLLDGSDAGGKAFRKPRRRLKRKPSKTEETDEFSNQRVMANVRERQRTQSL 378
               ||    ..|.|:..|..:      .:.:::|:||                .|.|||:|.|.|
  Rat    76 ---PA----PESGGARADAKE------EQQQQQLRRK----------------INSRERKRMQDL 111

  Fly   379 NDAFKSLQQII--------PTLPSDKLSKIQTLKLATRYIDFLCRMLSSSDISLLKALEAQGSPS 435
            |.|..:|:::|        ...|..|||||.||.||..||    .:|.||...|.:||.....|:
  Rat   112 NLAMDALREVILPYSAAHCQGAPGRKLSKIATLLLARNYI----LLLGSSLQELRRALGDGAGPA 172

  Fly   436 A--YGSASSLLSAAANGAEADLKCLRKANGAPIIPPEKL 472
            |  ...|...|.|||.|:      :..|.|| :.|||.|
  Rat   173 APRLLLAGLPLLAAAPGS------VLLAPGA-VGPPETL 204

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
twiNP_001033967.1 HLH 363..413 CDD:278439 23/57 (40%)
Olig1NP_068538.2 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 41..105 19/93 (20%)
bHLH_TS_OLIG1 96..165 CDD:381512 30/88 (34%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.