DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment twi and Twist2

DIOPT Version :9

Sequence 1:NP_001033967.1 Gene:twi / 37655 FlyBaseID:FBgn0003900 Length:490 Species:Drosophila melanogaster
Sequence 2:NP_067723.1 Gene:Twist2 / 59327 RGDID:621286 Length:160 Species:Rattus norvegicus


Alignment Length:213 Identity:74/213 - (34%)
Similarity:98/213 - (46%) Gaps:67/213 - (31%)


- Green bases have known domain annotations that are detailed below.


  Fly   279 PANSLNGSAYSSSDRDDMEYARHNALSSVSDLNGGVMSPACLADDGSAGSLLDGSDAGGKAFRKP 343
            |.:|| |::....:|....:.|....|..|            ::|||.               .|
  Rat    11 PVDSL-GTSEEELERQPKRFGRKRRYSKKS------------SEDGSP---------------TP 47

  Fly   344 RRRLKRKPSKTEETDEFSNQRVMANVRERQRTQSLNDAFKSLQQIIPTLPSDKLSKIQTLKLATR 408
            .:|.|:.....:..:|..:||::|||||||||||||:||.:|::|||||||||||||||||||.|
  Rat    48 GKRGKKGSPSAQSFEELQSQRILANVRERQRTQSLNEAFAALRKIIPTLPSDKLSKIQTLKLAAR 112

  Fly   409 YIDFLCRMLSSSDISLLKALEAQGSPSAYGSASSLLSAAANGAEADLKCLRKANGAPIIPPEKLS 473
            |||||.::|.|.::.                                   .|......:..|:||
  Rat   113 YIDFLYQVLQSDEMD-----------------------------------NKMTSCSYVAHERLS 142

  Fly   474 YLFGVWRMEG----DAQH 487
            |.|.||||||    .|.|
  Rat   143 YAFSVWRMEGAWSMSASH 160

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
twiNP_001033967.1 HLH 363..413 CDD:278439 41/49 (84%)
Twist2NP_067723.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..63 14/79 (18%)
bHLH_TS_TWIST2 51..132 CDD:381543 48/115 (42%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C166343491
Domainoid 1 1.000 90 1.000 Domainoid score I7605
eggNOG 1 0.900 - - E1_KOG4447
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0001055
OrthoInspector 1 1.000 - - otm45455
orthoMCL 1 0.900 - - OOG6_107717
Panther 1 1.100 - - LDO PTHR23349
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X1477
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
109.740

Return to query results.
Submit another query.