DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment twi and Bhlhe22

DIOPT Version :10

Sequence 1:NP_523816.2 Gene:twi / 37655 FlyBaseID:FBgn0003900 Length:490 Species:Drosophila melanogaster
Sequence 2:NP_067535.3 Gene:Bhlhe22 / 59058 MGIID:1930001 Length:355 Species:Mus musculus


Alignment Length:51 Identity:14/51 - (27%)
Similarity:22/51 - (43%) Gaps:11/51 - (21%)


- Green bases have known domain annotations that are detailed below.


  Fly    75 VAALQENLEHELKKVS----GGKTLKTKSSNN-------DLNAVAGTETTG 114
            :|::|:.|:.||..:.    .|.||..:|..|       |:....||...|
Mouse     1 MASMQKRLQKELLALQNDPPAGMTLNERSVQNTITEWFIDMEGAQGTVYEG 51

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
twiNP_523816.2 bHLH_TS_TWIST 363..421 CDD:381470
Bhlhe22NP_067535.3 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 34..90 4/18 (22%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 128..215
bHLH_TS_bHLHe22_bHLHb5 217..286 CDD:381524
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.