DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment twi and hand2

DIOPT Version :9

Sequence 1:NP_001033967.1 Gene:twi / 37655 FlyBaseID:FBgn0003900 Length:490 Species:Drosophila melanogaster
Sequence 2:NP_571701.3 Gene:hand2 / 58150 ZFINID:ZDB-GENE-000511-1 Length:205 Species:Danio rerio


Alignment Length:216 Identity:61/216 - (28%)
Similarity:95/216 - (43%) Gaps:48/216 - (22%)


- Green bases have known domain annotations that are detailed below.


  Fly   256 PHQQSHAQMHFQNAYRQSFEGYEPANSLNGSAYSSSDRDDMEYARHNALSSVSDLN--GGVMSPA 318
            ||   |..||        .:||       ..|.:|...::..|. |..|.|..:::  ...|:|:
Zfish     8 PH---HPVMH--------HDGY-------SFAAASRCHEEPPYF-HGWLISHPEMSPPDYTMAPS 53

  Fly   319 CLADDGSAGSLLDGSDAGG----KAFRKPRRRLKRKPSKTEETDEFSNQRVMANVRERQRTQSLN 379
            ...:..:....||.|..||    .|.....|.:||:|:              ||.:||:||||:|
Zfish    54 YSPEYSTGAPGLDHSHYGGVPGAGAVGMGPRTVKRRPT--------------ANRKERRRTQSIN 104

  Fly   380 DAFKSLQQIIPTLPSD-KLSKIQTLKLATRYIDFLCRMLSSSDISLLKALEAQGSPSAYGSASSL 443
            .||..|::.||.:|:| |||||:||:|||.||.:|..:|...        |..|...|:.:....
Zfish   105 SAFAELRECIPNVPADTKLSKIKTLRLATSYIAYLMDILDKD--------EQNGETEAFKAEFKK 161

  Fly   444 LSAAANGAEADLKCLRKANGA 464
            ..|.....:.::..:.|::|:
Zfish   162 TDAKEERRKKEMNDVLKSSGS 182

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
twiNP_001033967.1 HLH 363..413 CDD:278439 28/50 (56%)
hand2NP_571701.3 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 76..103 12/40 (30%)
HLH 88..139 CDD:278439 30/64 (47%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 158..194 3/25 (12%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C170583735
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R5507
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
ZFIN 00.000 Not matched by this tool.
43.830

Return to query results.
Submit another query.