DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment twi and atoh8

DIOPT Version :9

Sequence 1:NP_001033967.1 Gene:twi / 37655 FlyBaseID:FBgn0003900 Length:490 Species:Drosophila melanogaster
Sequence 2:NP_001073460.2 Gene:atoh8 / 561606 ZFINID:ZDB-GENE-061215-7 Length:266 Species:Danio rerio


Alignment Length:218 Identity:43/218 - (19%)
Similarity:80/218 - (36%) Gaps:65/218 - (29%)


- Green bases have known domain annotations that are detailed below.


  Fly   237 FLPLYNNQQQQSQQLQQQQPHQQSHAQMHFQNAYRQSFEGYEPANSLNGSAYSSSDRDDMEYARH 301
            :..||.|....::.|....|.:...:::                         .:.|||.  .|:
Zfish    40 YFKLYKNPHLMAETLGDGSPQETHRSEI-------------------------ITSRDDS--VRN 77

  Fly   302 NALSSVSDLNGGVMSPACLADD-----------------GSAGSLLDG----------------- 332
            :.|::..|:....::.|.:.|.                 ....|:|..                 
Zfish    78 DVLNTAVDMRINTITAAEVPDSKLRSVSEKTVNSKIVQASPQVSVLSAPQVFPLERVVLSQRAAS 142

  Fly   333 -SDAGGKAFRKPRRRLKRKPS--KTEETDEFSNQRVMANVRERQRTQSLNDAFKSLQQIIPTLP- 393
             :.|||....:..|:...:||  .||.......:|::||.|||.|..:::.||::|::.:|... 
Zfish   143 QAPAGGSERAESPRKRAGEPSGVVTEIKAIQQTRRLLANARERTRVHTISAAFEALRKQVPCYSY 207

  Fly   394 SDKLSKIQTLKLATRYIDFLCRM 416
            ..||||:..|::|..||..|.::
Zfish   208 GQKLSKLAILRIACNYILSLAQL 230

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
twiNP_001033967.1 HLH 363..413 CDD:278439 19/50 (38%)
atoh8NP_001073460.2 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 140..164 5/23 (22%)
Basic motif, degenerate. /evidence=ECO:0000255|PROSITE-ProRule:PRU00981 175..188 6/12 (50%)
HLH 176..227 CDD:278439 19/50 (38%)
Helix-loop-helix motif. /evidence=ECO:0000255|PROSITE-ProRule:PRU00981 189..227 12/37 (32%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.