Sequence 1: | NP_001033967.1 | Gene: | twi / 37655 | FlyBaseID: | FBgn0003900 | Length: | 490 | Species: | Drosophila melanogaster |
---|---|---|---|---|---|---|---|---|---|
Sequence 2: | NP_001073460.2 | Gene: | atoh8 / 561606 | ZFINID: | ZDB-GENE-061215-7 | Length: | 266 | Species: | Danio rerio |
Alignment Length: | 218 | Identity: | 43/218 - (19%) |
---|---|---|---|
Similarity: | 80/218 - (36%) | Gaps: | 65/218 - (29%) |
- Green bases have known domain annotations that are detailed below.
Fly 237 FLPLYNNQQQQSQQLQQQQPHQQSHAQMHFQNAYRQSFEGYEPANSLNGSAYSSSDRDDMEYARH 301
Fly 302 NALSSVSDLNGGVMSPACLADD-----------------GSAGSLLDG----------------- 332
Fly 333 -SDAGGKAFRKPRRRLKRKPS--KTEETDEFSNQRVMANVRERQRTQSLNDAFKSLQQIIPTLP- 393
Fly 394 SDKLSKIQTLKLATRYIDFLCRM 416 |
Gene | Sequence | Domain | Region | External ID | Identity |
---|---|---|---|---|---|
twi | NP_001033967.1 | HLH | 363..413 | CDD:278439 | 19/50 (38%) |
atoh8 | NP_001073460.2 | Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite | 140..164 | 5/23 (22%) | |
Basic motif, degenerate. /evidence=ECO:0000255|PROSITE-ProRule:PRU00981 | 175..188 | 6/12 (50%) | |||
HLH | 176..227 | CDD:278439 | 19/50 (38%) | ||
Helix-loop-helix motif. /evidence=ECO:0000255|PROSITE-ProRule:PRU00981 | 189..227 | 12/37 (32%) |
Tool | Simple Score | Weighted Score | Original Tool Information | |||
---|---|---|---|---|---|---|
BLAST Result | Score | Score Type | Cluster ID | |||
Compara | 0 | 0.000 | Not matched by this tool. | |||
Domainoid | 0 | 0.000 | Not matched by this tool. | |||
eggNOG | 0 | 0.000 | Not matched by this tool. | |||
Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
Homologene | 0 | 0.000 | Not matched by this tool. | |||
Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
OMA | 0 | 0.000 | Not matched by this tool. | |||
OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
Panther | 0 | 0.000 | Not matched by this tool. | |||
Phylome | 1 | 0.910 | - | - | ||
RoundUp | 0 | 0.000 | Not matched by this tool. | |||
SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
TreeFam | 0 | 0.000 | Not matched by this tool. | |||
ZFIN | 0 | 0.000 | Not matched by this tool. | |||
1 | 0.910 |