DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment twi and Neurod6

DIOPT Version :9

Sequence 1:NP_001033967.1 Gene:twi / 37655 FlyBaseID:FBgn0003900 Length:490 Species:Drosophila melanogaster
Sequence 2:NP_001102707.1 Gene:Neurod6 / 500137 RGDID:1562793 Length:337 Species:Rattus norvegicus


Alignment Length:131 Identity:43/131 - (32%)
Similarity:59/131 - (45%) Gaps:34/131 - (25%)


- Green bases have known domain annotations that are detailed below.


  Fly   343 PRRRLKRKPSKTE---ETDEFSNQRVMANVRERQRTQSLNDAFKSLQQIIPTL-PSDKLSKIQTL 403
            ||||..||...|:   |..:|..|.  ||.|||.|...||||..:|::::|.. .:.|||||:||
  Rat    74 PRRRGLRKKKTTKLRLERVKFRRQE--ANARERNRMHGLNDALDNLRKVVPCYSKTQKLSKIETL 136

  Fly   404 KLATRYI-------------------DFLCRMLSSSDISLLKA---------LEAQGSPSAYGSA 440
            :||..||                   ..||:.||....:|:..         |..||..:|:.:.
  Rat   137 RLAKNYIWALSEILRIGKRPDLLTFVQNLCKGLSQPTTNLVAGCLQLNARSFLMGQGGEAAHHTR 201

  Fly   441 S 441
            |
  Rat   202 S 202

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
twiNP_001033967.1 HLH 363..413 CDD:278439 24/69 (35%)
Neurod6NP_001102707.1 HLH 100..151 CDD:197674 22/50 (44%)
Neuro_bHLH 153..272 CDD:315246 10/50 (20%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
21.910

Return to query results.
Submit another query.