DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment twi and atoh1b

DIOPT Version :9

Sequence 1:NP_001033967.1 Gene:twi / 37655 FlyBaseID:FBgn0003900 Length:490 Species:Drosophila melanogaster
Sequence 2:NP_001122151.1 Gene:atoh1b / 493915 ZFINID:ZDB-GENE-041201-1 Length:206 Species:Danio rerio


Alignment Length:165 Identity:50/165 - (30%)
Similarity:76/165 - (46%) Gaps:35/165 - (21%)


- Green bases have known domain annotations that are detailed below.


  Fly   288 YSSSDRDDMEYARHNALSSVSDLNGGVMSPACLADDGSAGSLLDGSDAGGKAFRKPRRRLKRKP- 351
            |||:..:   |||   .::.|.:...:.||...::|..|||                   |.:| 
Zfish    43 YSSAVEN---YAR---TAADSPMEKYISSPQAASEDHHAGS-------------------KARPG 82

  Fly   352 SKTEETDEFSNQRVMANVRERQRTQSLNDAFKSLQQIIPTLPSD-KLSKIQTLKLATRYIDFLCR 415
            ||...:....::||.||.|||:|...||.||..|:.:||:|.:: ||||..||::|..||..|. 
Zfish    83 SKASVSGPQRHRRVAANARERRRMHGLNRAFDKLRSVIPSLENEKKLSKYDTLQMAQIYITELS- 146

  Fly   416 MLSSSDISLLKALEAQGSPSAYGSASSLLSAAANG 450
                   .||:.:...|:|.:..:|......|.:|
Zfish   147 -------ELLEGVVQSGAPGSQRTAIPYAIDATSG 174

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
twiNP_001033967.1 HLH 363..413 CDD:278439 25/50 (50%)
atoh1bNP_001122151.1 HLH 92..150 CDD:238036 27/65 (42%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0001055
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
21.910

Return to query results.
Submit another query.