DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment twi and MYF6

DIOPT Version :9

Sequence 1:NP_001033967.1 Gene:twi / 37655 FlyBaseID:FBgn0003900 Length:490 Species:Drosophila melanogaster
Sequence 2:NP_002460.1 Gene:MYF6 / 4618 HGNCID:7566 Length:242 Species:Homo sapiens


Alignment Length:196 Identity:44/196 - (22%)
Similarity:75/196 - (38%) Gaps:60/196 - (30%)


- Green bases have known domain annotations that are detailed below.


  Fly   316 SPACLADDGSAGSLLD------GSDAGGK-------AFRKPR----------RRLKRKPSKTEET 357
            ||.....||:.....|      |||:.|:       ..:.|.          :..|||.:.|:  
Human    31 SPLYPGSDGTLSPCQDQMPPEAGSDSSGEEHVLAPPGLQPPHCPGQCLIWACKTCKRKSAPTD-- 93

  Fly   358 DEFSNQRVMANVRERQRTQSLNDAFKSLQQIIPTLPSDKLSKIQTLKLATRYIDFLCRMLSSSD- 421
                 :|..|.:|||:|.:.:|:||::|::.....|:.:|.|::.|:.|..||:.|..:|...| 
Human    94 -----RRKAATLRERRRLKKINEAFEALKRRTVANPNQRLPKVEILRSAISYIERLQDLLHRLDQ 153

  Fly   422 -----------------------ISLLKALEAQGSPSAYGSASSLLSAAANGAEAD------LKC 457
                                   ...|:...:|....:..|...:::|...||..|      |:|
Human   154 QEKMQELGVDPFSYRPKQENLEGADFLRTCSSQWPSVSDHSRGLVITAKEGGASIDSSASSSLRC 218

  Fly   458 L 458
            |
Human   219 L 219

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
twiNP_001033967.1 HLH 363..413 CDD:278439 17/49 (35%)
MYF6NP_002460.1 Basic 3..98 CDD:416335 15/73 (21%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 31..63 9/31 (29%)
bHLH_TS_MRF4_Myf6 93..156 CDD:381504 20/69 (29%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.