DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment twi and Fer2

DIOPT Version :9

Sequence 1:NP_001033967.1 Gene:twi / 37655 FlyBaseID:FBgn0003900 Length:490 Species:Drosophila melanogaster
Sequence 2:NP_001287359.1 Gene:Fer2 / 41961 FlyBaseID:FBgn0038402 Length:283 Species:Drosophila melanogaster


Alignment Length:292 Identity:78/292 - (26%)
Similarity:101/292 - (34%) Gaps:104/292 - (35%)


- Green bases have known domain annotations that are detailed below.


  Fly   213 STCTSPQSHFDFP--DEELPEHKAQVFLP--LYNNQQQ----------------------QSQQL 251
            |:.:.|.||..|.  |::|...     ||  :|..|.|                      .|..|
  Fly     9 SSSSPPISHLPFHNFDDDLIND-----LPSCIYAGQHQGGGATGGGGGSGGGGGSSGLRLSSNNL 68

  Fly   252 QQQQPHQQSHAQMHFQNAYRQSFEGYEPANSLNGSAYSSSDRDDMEYARHNALSSVSDLNGGVMS 316
            :..|.|...|:.   :|....|.......||..|:....:.            .|.|...||   
  Fly    69 RHIQQHYMQHSG---ENLLDSSTNPMGVHNSGGGAPLMCNS------------PSASSSGGG--- 115

  Fly   317 PACLADDGSAGSLLDGSDAGGKAFRKPRRRLKRKPSKTEETDEFSNQRVMANVRERQRTQ----- 376
              |    |:|||...|. |||     |........:.|  ...:..||..||||||:|.|     
  Fly   116 --C----GNAGSATPGG-AGG-----PNPGYGSVGAAT--ASSYKMQRQAANVRERKRIQRSAPT 166

  Fly   377 -----SLNDAFKSLQQIIPTLPSDK-LSKIQTLKLATRYIDFLCRMLSSSDISLLKALEAQGSPS 435
                 |:|.||..|:..:||.|.:| ||||.||:||..||..| |.:..:|...|..:|      
  Fly   167 GYTKCSINSAFDELRVHVPTFPYEKRLSKIDTLRLAIAYISLL-REVLQTDYDPLTYVE------ 224

  Fly   436 AYGSASSLLSAAANGAEADLKCLR---KANGA 464
                                ||||   ||:.|
  Fly   225 --------------------KCLRGEIKADRA 236

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
twiNP_001033967.1 HLH 363..413 CDD:278439 29/60 (48%)
Fer2NP_001287359.1 HLH 148..210 CDD:278439 30/62 (48%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45452833
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR23349
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.940

Return to query results.
Submit another query.