DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment twi and Fer3

DIOPT Version :9

Sequence 1:NP_001033967.1 Gene:twi / 37655 FlyBaseID:FBgn0003900 Length:490 Species:Drosophila melanogaster
Sequence 2:NP_524322.1 Gene:Fer3 / 41411 FlyBaseID:FBgn0037937 Length:195 Species:Drosophila melanogaster


Alignment Length:127 Identity:42/127 - (33%)
Similarity:62/127 - (48%) Gaps:28/127 - (22%)


- Green bases have known domain annotations that are detailed below.


  Fly   325 SAGSLLDGSDAGGKAFRKPRRRLKRKPSKTEETDEFSNQRVMANVRERQRTQSLNDAFKSLQQII 389
            |.....:||.:..|   |.|||:....           ||..||:|||:|..:||:||..|::.:
  Fly    63 STNGRANGSSSSSK---KTRRRVASMA-----------QRRAANIRERRRMFNLNEAFDKLRRKV 113

  Fly   390 PTLPSDK-LSKIQTLKLATRYIDFLCRMLSSSDISLLKALEAQGSPSAYGSASSLLSAAANG 450
            ||...:| ||:|:||:||..||.|:..:||             |:||....:.|.:..:.||
  Fly   114 PTFAYEKRLSRIETLRLAITYIGFMAELLS-------------GTPSNSHKSRSDVYGSMNG 162

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
twiNP_001033967.1 HLH 363..413 CDD:278439 25/50 (50%)
Fer3NP_524322.1 HLH 87..135 CDD:278439 23/47 (49%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45452830
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR23349
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.940

Return to query results.
Submit another query.