DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment twi and sage

DIOPT Version :10

Sequence 1:NP_523816.2 Gene:twi / 37655 FlyBaseID:FBgn0003900 Length:490 Species:Drosophila melanogaster
Sequence 2:NP_524287.1 Gene:sage / 41105 FlyBaseID:FBgn0037672 Length:268 Species:Drosophila melanogaster


Alignment Length:192 Identity:47/192 - (24%)
Similarity:73/192 - (38%) Gaps:58/192 - (30%)


- Green bases have known domain annotations that are detailed below.


  Fly   279 PANSLNGS-----------------AYSSSDRDDMEYARHNALSSVSDLNGGVMSP--ACLADDG 324
            ||.|||.:                 :||.|.....|...||.         |::.|  :.:....
  Fly    60 PAVSLNYTLTADGAGLLAYAPTHPHSYSPSVMGGYEKEAHNM---------GLLPPTYSVIPQPV 115

  Fly   325 S---AGSLLDGSDAGGKAFRKPRRRL-----------------------KRKPSKTEETDEF-SN 362
            |   ||.:..||..|.:. .||...:                       :..|:..|:..:. .:
  Fly   116 SMWHAGQVATGSPVGLEC-NKPSELVPPPMYMSYSGGSIANSTEVDIAKEHNPAWREKALQMEKD 179

  Fly   363 QRVMANVRERQRTQSLNDAFKSLQQIIP-TLPS-DKLSKIQTLKLATRYIDFLCRMLSSSDI 422
            .|..|..|||.|.:.:|.||..|:..:| :.|: .|.|||::|::|..||:.|..||..|.:
  Fly   180 YRRTACDRERTRMRDMNRAFDLLRSKLPISKPNGKKYSKIESLRIAINYINHLQAMLRESSV 241

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
twiNP_523816.2 bHLH_TS_TWIST 363..421 CDD:381470 23/59 (39%)
sageNP_524287.1 bHLH_TS 181..236 CDD:381396 21/54 (39%)

Return to query results.
Submit another query.