powered by:
Protein Alignment twi and Ferd3l
DIOPT Version :9
Sequence 1: | NP_001033967.1 |
Gene: | twi / 37655 |
FlyBaseID: | FBgn0003900 |
Length: | 490 |
Species: | Drosophila melanogaster |
Sequence 2: | NP_001102450.1 |
Gene: | Ferd3l / 366598 |
RGDID: | 1311812 |
Length: | 166 |
Species: | Rattus norvegicus |
Alignment Length: | 60 |
Identity: | 28/60 - (46%) |
Similarity: | 42/60 - (70%) |
Gaps: | 1/60 - (1%) |
- Green bases have known domain annotations that are detailed below.
Fly 363 QRVMANVRERQRTQSLNDAFKSLQQIIPTLPSDK-LSKIQTLKLATRYIDFLCRMLSSSD 421
||..||:|||:|..:||:||..|::.:||...:| ||:|:||:||..||.|:..:|.|.:
Rat 102 QRQAANIRERKRMFNLNEAFDQLRRKVPTFAYEKRLSRIETLRLAIVYISFMTELLQSKE 161
|
Known Domains:
Indicated by green bases in alignment.
Gene | Sequence | Domain | Region |
External ID | Identity |
twi | NP_001033967.1 |
HLH |
363..413 |
CDD:278439 |
25/50 (50%) |
Ferd3l | NP_001102450.1 |
HLH |
102..154 |
CDD:278439 |
26/51 (51%) |
Information from Original Tools:
Tool |
Simple Score |
Weighted Score |
Original Tool Information |
BLAST Result |
Score |
Score Type |
Cluster ID |
Compara |
1 |
0.930 |
- |
- |
|
C166343504 |
Domainoid |
0 | 0.000 |
Not matched by this tool. |
eggNOG |
0 | 0.000 |
Not matched by this tool. |
Hieranoid |
0 | 0.000 |
Not matched by this tool. |
Homologene |
0 | 0.000 |
Not matched by this tool. |
Inparanoid |
0 | 0.000 |
Not matched by this tool. |
OMA |
0 | 0.000 |
Not matched by this tool. |
OrthoDB |
0 | 0.000 |
Not matched by this tool. |
OrthoFinder |
0 | 0.000 |
Not matched by this tool. |
OrthoInspector |
0 | 0.000 |
Not matched by this tool. |
orthoMCL |
0 | 0.000 |
Not matched by this tool. |
Panther |
0 | 0.000 |
Not matched by this tool. |
Phylome |
1 |
0.910 |
- |
- |
|
|
SonicParanoid |
0 | 0.000 |
Not matched by this tool. |
SwiftOrtho |
0 | 0.000 |
Not matched by this tool. |
TreeFam |
0 | 0.000 |
Not matched by this tool. |
|
2 | 1.840 |
|
Return to query results.
Submit another query.