DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment twi and Bhlha9

DIOPT Version :9

Sequence 1:NP_001033967.1 Gene:twi / 37655 FlyBaseID:FBgn0003900 Length:490 Species:Drosophila melanogaster
Sequence 2:XP_038943763.1 Gene:Bhlha9 / 363656 RGDID:1311234 Length:230 Species:Rattus norvegicus


Alignment Length:163 Identity:49/163 - (30%)
Similarity:73/163 - (44%) Gaps:23/163 - (14%)


- Green bases have known domain annotations that are detailed below.


  Fly   323 DGSAGSLLDGSDAGGKAFRKPRRRLKRKPS----KTEETDEFSNQRVMANVRERQRTQSLNDAFK 383
            :.|.|.|.......|:.|...||.|..:..    |.|.......:|:.||||||:|....|:||.
  Rat    17 EDSVGDLGHSCPEAGRNFGVLRRSLAEEEEVAGRKRERPARSKARRMAANVRERKRILDYNEAFN 81

  Fly   384 SLQQIIP-TLPSDKLSKIQTLKLATRYIDFLCRMLSSSDISLLKA--LEAQGSPSAYGSAS---- 441
            :|::.:. .|...:||||.||:.|...|..|..:|.:|.......  ||..|. :|:||::    
  Rat    82 ALRRALQHDLGGKRLSKIATLRRAIHRITALSLVLRASPAPRWPCGHLECHGQ-AAHGSSAGDSG 145

  Fly   442 -----SLLSAAANGAEADLKCLRKANGAPIIPP 469
                 |:||.||.      ...|:...:|::||
  Rat   146 FSVPRSVLSPAAP------SLARRDTASPLVPP 172

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
twiNP_001033967.1 HLH 363..413 CDD:278439 21/50 (42%)
Bhlha9XP_038943763.1 bHLH_TS_bHLHa9 54..116 CDD:381482 22/61 (36%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C166343510
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.840

Return to query results.
Submit another query.