DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment twi and FIGLA

DIOPT Version :9

Sequence 1:NP_001033967.1 Gene:twi / 37655 FlyBaseID:FBgn0003900 Length:490 Species:Drosophila melanogaster
Sequence 2:NP_001004311.2 Gene:FIGLA / 344018 HGNCID:24669 Length:219 Species:Homo sapiens


Alignment Length:102 Identity:38/102 - (37%)
Similarity:54/102 - (52%) Gaps:9/102 - (8%)


- Green bases have known domain annotations that are detailed below.


  Fly   346 RLKRKP----SKTEETDEFSNQRVMANVRERQRTQSLNDAFKSLQQIIPTLP-SDKLSKIQTLKL 405
            ||||.|    |.||.......:|.:||.:||:|.::||..|..|:.::|.|| |.|.||:..||.
Human    45 RLKRLPSGGYSSTENLQLVLERRRVANAKERERIKNLNRGFARLKALVPFLPQSRKPSKVDILKG 109

  Fly   406 ATRYIDFLCRMLSSSDISLLKALEAQGSPSAYGSASS 442
            ||.||..|..:|..:..|..:..:.|    :|.:.||
Human   110 ATEYIQVLSDLLEGAKDSKKQDPDEQ----SYSNNSS 142

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
twiNP_001033967.1 HLH 363..413 CDD:278439 23/50 (46%)
FIGLANP_001004311.2 HLH 65..122 CDD:238036 24/56 (43%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 124..151 5/23 (22%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C165149625
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
21.840

Return to query results.
Submit another query.