DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment twi and CG33557

DIOPT Version :9

Sequence 1:NP_001033967.1 Gene:twi / 37655 FlyBaseID:FBgn0003900 Length:490 Species:Drosophila melanogaster
Sequence 2:NP_001014730.1 Gene:CG33557 / 3346145 FlyBaseID:FBgn0053557 Length:150 Species:Drosophila melanogaster


Alignment Length:147 Identity:48/147 - (32%)
Similarity:69/147 - (46%) Gaps:35/147 - (23%)


- Green bases have known domain annotations that are detailed below.


  Fly   305 SSVSDLNGGVMSPACLADD----GSA---GSLLDGSDA--------GGKAFRKPRRRLKRKPSKT 354
            ||.|..:..:|  |..|.|    |||   |:..|..|:        ||:..:...||  |.|   
  Fly     5 SSSSSFSNYLM--AVFAQDSNSSGSASGSGAAADSEDSQIGQEANPGGQENQGNHRR--RPP--- 62

  Fly   355 EETDEFSNQRVMANVRERQRTQSLNDAFKSLQQIIPTLPSD-KLSKIQTLKLATRYIDFLCRMLS 418
                     |...|.|||.||.::|.|:::|:.:|||.|.: |||||:.::||:.||..|...|.
  Fly    63 ---------RQKINARERYRTFNVNSAYEALRNLIPTEPMNRKLSKIEIIRLASSYITHLSSTLE 118

  Fly   419 SS---DISLLKALEAQG 432
            :.   ...||...|::|
  Fly   119 TGTECQPCLLHKYESEG 135

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
twiNP_001033967.1 HLH 363..413 CDD:278439 23/50 (46%)
CG33557NP_001014730.1 HLH 67..119 CDD:197674 24/51 (47%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45452826
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR23349
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.940

Return to query results.
Submit another query.