DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment twi and LOC3290329

DIOPT Version :10

Sequence 1:NP_523816.2 Gene:twi / 37655 FlyBaseID:FBgn0003900 Length:490 Species:Drosophila melanogaster
Sequence 2:XP_061505703.1 Gene:LOC3290329 / 3290329 VectorBaseID:AGAMI1_014996 Length:225 Species:Anopheles gambiae


Alignment Length:124 Identity:40/124 - (32%)
Similarity:51/124 - (41%) Gaps:35/124 - (28%)


- Green bases have known domain annotations that are detailed below.


  Fly   315 MSPACLADDGSAGSLLDGSDAGGKAFRKPRRRLKRKPSKTEETDEFSNQRVMANVRERQRTQSLN 379
            |||          :|...:..||.:.|: ||:|   ||.:......  :|..||.|||.|...||
Mosquito     1 MSP----------NLTTATVGGGGSIRR-RRKL---PSGSGVLSLV--KRKKANQRERNRMHGLN 49

  Fly   380 DAFKSLQQIIP-------------------TLPSDKLSKIQTLKLATRYIDFLCRMLSS 419
            ||...|:..:|                   ..|..|||||.||:||..||..|..:|.|
Mosquito    50 DALDRLRMCVPLPASLTTATVRPDDAREATPTPPQKLSKIDTLRLAQNYIAVLLEVLHS 108

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
twiNP_523816.2 bHLH_TS_TWIST 363..421 CDD:381470 28/76 (37%)
LOC3290329XP_061505703.1 None

Return to query results.
Submit another query.