DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment twi and HLH4C

DIOPT Version :9

Sequence 1:NP_001033967.1 Gene:twi / 37655 FlyBaseID:FBgn0003900 Length:490 Species:Drosophila melanogaster
Sequence 2:NP_001259243.1 Gene:HLH4C / 31397 FlyBaseID:FBgn0011277 Length:191 Species:Drosophila melanogaster


Alignment Length:210 Identity:59/210 - (28%)
Similarity:86/210 - (40%) Gaps:56/210 - (26%)


- Green bases have known domain annotations that are detailed below.


  Fly   270 YRQSFEGYEPANSLNGSAYSSSDRDDM-----------EYARHNALSSVSDLNGGVMSPACLADD 323
            |..|.....|..|::.|.|...|.|:|           :|    |.|:..|::....  |.:|.:
  Fly     3 YDMSHMAAGPPQSISLSRYYLVDDDEMIGPNNPHLVNEDY----AASTTLDIDKRFQ--ARMACE 61

  Fly   324 GSAG------------------SLLDGSDAGGKAFRKPRRRLKRKPSKTEETDEFSNQRVMANVR 370
            .:|.                  :.||.|:..|.: |:.|||.:|...|         .|.....|
  Fly    62 TAAQPAPPPPPTPAPRRRTTPIAHLDPSELVGLS-REERRRRRRATLK---------YRTAHATR 116

  Fly   371 ERQRTQSLNDAFKSLQQIIPTLPSD-KLSKIQTLKLATRYIDFLCRMLSSSDISLLKALEAQGSP 434
            ||.|.::.|.:|..|::::||||.| |||||:.||||..||.:|..:|.:          . .|.
  Fly   117 ERIRVEAFNVSFAELRKLLPTLPPDKKLSKIEILKLAICYIAYLNHVLET----------PXDSA 171

  Fly   435 SAYGSASSLLSAAAN 449
            .|...|:|.|...||
  Fly   172 GASSFATSCLFNEAN 186

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
twiNP_001033967.1 HLH 363..413 CDD:278439 24/50 (48%)
HLH4CNP_001259243.1 HLH 108..165 CDD:238036 26/65 (40%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.