DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment twi and HLH3B

DIOPT Version :9

Sequence 1:NP_001033967.1 Gene:twi / 37655 FlyBaseID:FBgn0003900 Length:490 Species:Drosophila melanogaster
Sequence 2:NP_525055.1 Gene:HLH3B / 31249 FlyBaseID:FBgn0011276 Length:376 Species:Drosophila melanogaster


Alignment Length:350 Identity:81/350 - (23%)
Similarity:122/350 - (34%) Gaps:98/350 - (28%)


- Green bases have known domain annotations that are detailed below.


  Fly   127 SSGNNPSGFD--GQASSGSSWNEHGKRARSSGDYDCQTGGSLVMQPEHKKLIHQQQQQQQQHQQQ 189
            ||.|.....|  ..||||||.:.....:..||..:  ..||:            :.....:|...
  Fly     6 SSSNGADNADERSTASSGSSGHSQTNESPRSGHLN--GNGSM------------RDTAAGRHPPA 56

  Fly   190 IYVDYLPTTVDEVASAQSCPGVQSTCTSPQSHFDFPDEELPEHKAQVFLPLYNNQQQQSQQLQQQ 254
            :.....|....:..|.....|     .:..|.|...|.|..|...:.::.|..||...::.|...
  Fly    57 LLRHATPHLQPKTESISDGDG-----DAELSDFSLNDTEEDEEDLRDYIVLNGNQADANRSLSSS 116

  Fly   255 QPHQQSHAQMHFQNAYRQSFEGYEPANSLNGSAYSSSDRDDMEYARHNALSSVSDLNGGVMSPAC 319
               .:||::                 |.|..:..||.             |||....||      
  Fly   117 ---PRSHSR-----------------NGLLTAPASSG-------------SSVGGSGGG------ 142

  Fly   320 LADDGSAGSLLDGSDAGGKAFRKPRRRLKRKPSKTEETDEFSNQRVMANVRERQRTQSLNDAFKS 384
             ..:||.|:...|..:|..|....|                   :|..|.|||.|.|:::.||..
  Fly   143 -GGNGSGGNASSGGGSGVGATGGVR-------------------KVFTNTRERWRQQNVSGAFAE 187

  Fly   385 LQQIIPTLPSD-KLSKIQTLKLATRYIDFLCRMLSSSDISLLKALEAQGSPS----AYGSASSLL 444
            |::::||.|.| ||||.:.|:.|.:||..|..:|.         .:.:.:||    |....::..
  Fly   188 LRKLVPTHPPDKKLSKNEILRSAIKYIKLLTGILE---------WQQRQAPSHPIRAQMEPNNND 243

  Fly   445 SAAANGAEADLKCLRKANGAPIIPP 469
            :..|||..||.:.|..    |.:||
  Fly   244 NRMANGHAADGENLEN----PDVPP 264

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
twiNP_001033967.1 HLH 363..413 CDD:278439 22/50 (44%)
HLH3BNP_525055.1 HLH 171..222 CDD:197674 22/50 (44%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.