DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment twi and twist3

DIOPT Version :9

Sequence 1:NP_001033967.1 Gene:twi / 37655 FlyBaseID:FBgn0003900 Length:490 Species:Drosophila melanogaster
Sequence 2:NP_571060.2 Gene:twist3 / 30176 ZFINID:ZDB-GENE-000210-7 Length:199 Species:Danio rerio


Alignment Length:160 Identity:67/160 - (41%)
Similarity:81/160 - (50%) Gaps:54/160 - (33%)


- Green bases have known domain annotations that are detailed below.


  Fly   343 PRRRLKRKPSKTEET-------------------DEFSNQRVMANVRERQRTQSLNDAFKSLQQI 388
            |:|..:..||.:..:                   ::...|||:||||||||||||||||.||::|
Zfish    67 PKRPKRSSPSSSSSSSSSLVPVVSSVSPVPGQPFEDLHTQRVIANVRERQRTQSLNDAFASLRKI 131

  Fly   389 IPTLPSDKLSKIQTLKLATRYIDFLCRMLSSSDISLLKALEAQGSPSAYGSASSLLSAAANGAEA 453
            |||||||||||||.||||:||||||.::|.|.                               |.
Zfish   132 IPTLPSDKLSKIQILKLASRYIDFLYQVLQSD-------------------------------EM 165

  Fly   454 DLKCLRKANGAPIIPPEKLSYLFGVWRMEG 483
            |.| |...|   .:..|:|||.|.||||||
Zfish   166 DAK-LASCN---YLAHERLSYAFSVWRMEG 191

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
twiNP_001033967.1 HLH 363..413 CDD:278439 43/49 (88%)
twist3NP_571060.2 HLH 106..156 CDD:278439 43/49 (88%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C170583773
Domainoid 1 1.000 91 1.000 Domainoid score I7661
eggNOG 1 0.900 - - E1_KOG4447
Hieranoid 00.000 Not matched by this tool.
Homologene 1 1.000 - - H101975
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0001055
OrthoInspector 1 1.000 - - otm25873
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR23349
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R5507
SonicParanoid 1 1.000 - - X1477
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
109.870

Return to query results.
Submit another query.