DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment twi and tcf15

DIOPT Version :9

Sequence 1:NP_001033967.1 Gene:twi / 37655 FlyBaseID:FBgn0003900 Length:490 Species:Drosophila melanogaster
Sequence 2:NP_571047.1 Gene:tcf15 / 30159 ZFINID:ZDB-GENE-980605-20 Length:183 Species:Danio rerio


Alignment Length:166 Identity:58/166 - (34%)
Similarity:78/166 - (46%) Gaps:28/166 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly   299 ARHNALSSVSDLNGGVMSPACLADDGSAGSLLDGSDA---GGKAFRKPRRRLKRKPSKTEETDEF 360
            |.|.|...||          .:::|....|..|||..   |.....:.|||:.||  .|..:...
Zfish    10 ATHLAYPDVS----------MMSEDEENRSESDGSSEQSYGCCPSAEKRRRMSRK--TTVGSVVI 62

  Fly   361 SNQRVMANVRERQRTQSLNDAFKSLQQIIPTLPSD-KLSKIQTLKLATRYIDFLCRMLSSSDISL 424
            ..||..||.|||.||||:|.||.:|:.:|||.|.| |||||:||:||:.||..|..:|...|   
Zfish    63 VKQRNAANARERDRTQSVNTAFTALRTLIPTEPVDRKLSKIETLRLASSYISHLANVLLIGD--- 124

  Fly   425 LKALEAQGSPSAYGSASSLLSAA--ANGAEADLKCL 458
                   |...|:...|::.||.  :.|.:....|:
Zfish   125 -------GGEDAHPCVSAVYSAQGDSGGKQPRTICI 153

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
twiNP_001033967.1 HLH 363..413 CDD:278439 31/50 (62%)
tcf15NP_571047.1 HLH 65..116 CDD:278439 31/50 (62%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C170583787
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
21.840

Return to query results.
Submit another query.