DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment twi and Tcf15

DIOPT Version :9

Sequence 1:NP_001033967.1 Gene:twi / 37655 FlyBaseID:FBgn0003900 Length:490 Species:Drosophila melanogaster
Sequence 2:NP_001162051.1 Gene:Tcf15 / 296272 RGDID:1308464 Length:195 Species:Rattus norvegicus


Alignment Length:181 Identity:62/181 - (34%)
Similarity:80/181 - (44%) Gaps:35/181 - (19%)


- Green bases have known domain annotations that are detailed below.


  Fly   320 LADDGSAGSLLDGSD------AGGKAFRK-PRRRLKRKPSKTEETDEFSNQRVMANVRERQRTQS 377
            |::|....|..|.||      .|.:|.|: |.....|:.|..........||..||.|||.||||
  Rat    21 LSEDEENRSESDASDQSFGCCEGLEAARRGPGPGSGRRASGGAGPVVVVRQRQAANARERDRTQS 85

  Fly   378 LNDAFKSLQQIIPTLPSD-KLSKIQTLKLATRYIDFLCRMLSSSDISLLKALEAQGSP--SAYGS 439
            :|.||.:|:.:|||.|.| |||||:||:||:.||..|..:|      ||......|.|  .|.|.
  Rat    86 VNTAFTALRTLIPTEPVDRKLSKIETLRLASSYIAHLANVL------LLGDAADDGQPCFRAAGG 144

  Fly   440 ASSLLSAA-----------------ANGAEADL--KCLRKANGAPIIPPEK 471
            ..|.:.||                 ..|:..||  .||:....||:..|.:
  Rat   145 GKSAVPAADGRQPRSICTFCLSNQRKGGSRRDLGGSCLKVRGVAPLRGPRR 195

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
twiNP_001033967.1 HLH 363..413 CDD:278439 31/50 (62%)
Tcf15NP_001162051.1 bHLH_TS_TCF15_paraxis 64..129 CDD:381476 34/70 (49%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C166343511
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.840

Return to query results.
Submit another query.