DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment twi and Mesp2

DIOPT Version :9

Sequence 1:NP_001033967.1 Gene:twi / 37655 FlyBaseID:FBgn0003900 Length:490 Species:Drosophila melanogaster
Sequence 2:NP_001099743.1 Gene:Mesp2 / 293046 RGDID:1305959 Length:368 Species:Rattus norvegicus


Alignment Length:210 Identity:64/210 - (30%)
Similarity:88/210 - (41%) Gaps:61/210 - (29%)


- Green bases have known domain annotations that are detailed below.


  Fly   298 YARHNALSSVSDLNGGVMSPACLADDGSAGS-----LLDGSDAGGKAFRKPR---------RRLK 348
            :|||      ||..    |||..:|  |:||     ....|.:.|.| |..|         ||.:
  Rat    24 WARH------SDST----SPASSSD--SSGSCPCYATRPPSQSTGPA-RSARNTQVAPNAPRRAR 75

  Fly   349 RKPSKTEETDEFSNQRVMANVRERQRTQSLNDAFKSLQQIIPTLPS-----DKLSKIQTLKLATR 408
            ..|:        ..||..|:.||:.|.::|..|.:.|::.:|  ||     ..|:||:||:||.|
  Rat    76 PAPA--------GGQRQSASEREKLRMRTLARALQELRRFLP--PSVAPAGQSLTKIETLRLAIR 130

  Fly   409 YIDFLCRMLSSSDISL----LKALEA-----------QGSPS-AYGSASSLLSAAANGAEADLKC 457
            ||..|..:|..|:.||    .::.:|           ..||| |.....||.|..::|  ....|
  Rat   131 YIGHLSALLGLSEDSLRRRRRRSADAAFSHRCPQCPDDSSPSQAQMLGPSLGSDISSG--LSWGC 193

  Fly   458 LRKANGAPIIPPEKL 472
            .....| |||.||.|
  Rat   194 PPACPG-PIISPENL 207

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
twiNP_001033967.1 HLH 363..413 CDD:278439 22/54 (41%)
Mesp2NP_001099743.1 HLH 82..135 CDD:278439 22/54 (41%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.