DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment twi and Fer1

DIOPT Version :9

Sequence 1:NP_001033967.1 Gene:twi / 37655 FlyBaseID:FBgn0003900 Length:490 Species:Drosophila melanogaster
Sequence 2:NP_001262334.1 Gene:Fer1 / 2768661 FlyBaseID:FBgn0037475 Length:256 Species:Drosophila melanogaster


Alignment Length:197 Identity:65/197 - (32%)
Similarity:85/197 - (43%) Gaps:30/197 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly   290 SSDRDDME--YARH--------NALSSVSDLNGGVMSPACLADDGSAGSLLDGSDAGGKAFRK-- 342
            |.|..|:|  .|||        ||.:|.||...|        |:.|:.| .|..||....|..  
  Fly     3 SMDNFDLEATMARHFFEGSQATNASTSSSDYFFG--------DEHSSES-DDEDDAYSSGFNSDQ 58

  Fly   343 --------PRRRLKRKPSKTEETDEFSNQRVMANVRERQRTQSLNDAFKSLQQIIPTLPSDK-LS 398
                    |..|...||.:.:...:.:.||..||:|||:|.||:|:||:.|:..|||||.:| ||
  Fly    59 ENTEKTFCPFSRRSHKPRRLKCASQMAQQRQAANLRERRRMQSINEAFEGLRTHIPTLPYEKRLS 123

  Fly   399 KIQTLKLATRYIDFLCRMLSSSDISLLKALEAQGSPSAYGSASSLLSAAANGAEADLKCLRKANG 463
            |:.|||||..||.||..|:..........|..|.:.........:|.....|....|...||.:.
  Fly   124 KVDTLKLAISYITFLSEMVKKDKNGNEPGLSLQRNYQKEPPKKIILKDRTGGVAHSLSWYRKGDR 188

  Fly   464 AP 465
            .|
  Fly   189 YP 190

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
twiNP_001033967.1 HLH 363..413 CDD:278439 30/50 (60%)
Fer1NP_001262334.1 HLH 92..144 CDD:197674 30/51 (59%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45452821
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR23349
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.940

Return to query results.
Submit another query.