DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment twi and neurod4

DIOPT Version :9

Sequence 1:NP_001033967.1 Gene:twi / 37655 FlyBaseID:FBgn0003900 Length:490 Species:Drosophila melanogaster
Sequence 2:NP_739568.2 Gene:neurod4 / 266958 ZFINID:ZDB-GENE-030730-1 Length:348 Species:Danio rerio


Alignment Length:171 Identity:55/171 - (32%)
Similarity:76/171 - (44%) Gaps:40/171 - (23%)


- Green bases have known domain annotations that are detailed below.


  Fly   322 DDGSAGSLLDGSDAGGKAFRKPRRRLKRKPSKTEETDE-FSNQRVMANVRERQRTQSLNDAFKSL 385
            :|...|  |||..|       |:||..:|...|:...| |..:|:.||.|||.|...||||..:|
Zfish    65 EDEEMG--LDGEKA-------PKRRGPKKKKMTKARQERFRARRIKANARERSRMHGLNDALDNL 120

  Fly   386 QQIIPTL-PSDKLSKIQTLKLATRYIDFLCRMLSSSDISLLKALEAQGSPSAYGSASSL---LSA 446
            ::::|.. .:.|||||:||:||..||           .:|.:.||:..||.::|....|   ||.
Zfish   121 RRVMPCYSKTQKLSKIETLRLARNYI-----------WALSEVLESGQSPESHGFVEMLCKGLSQ 174

  Fly   447 AANGAEA-------------DLKCLRKANGAPIIPPEKLSY 474
            ..:...|             |.||.....|.|...|  :||
Zfish   175 PTSNLVAGCLQLGPTTMLKLDEKCGVPGAGVPQGHP--ISY 213

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
twiNP_001033967.1 HLH 363..413 CDD:278439 24/50 (48%)
neurod4NP_739568.2 HLH 98..154 CDD:238036 25/66 (38%)
Neuro_bHLH 156..272 CDD:289310 15/60 (25%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
21.910

Return to query results.
Submit another query.