DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment twi and Tal2

DIOPT Version :10

Sequence 1:NP_523816.2 Gene:twi / 37655 FlyBaseID:FBgn0003900 Length:490 Species:Drosophila melanogaster
Sequence 2:NP_033343.1 Gene:Tal2 / 21350 MGIID:99540 Length:108 Species:Mus musculus


Alignment Length:72 Identity:33/72 - (45%)
Similarity:49/72 - (68%) Gaps:2/72 - (2%)


- Green bases have known domain annotations that are detailed below.


  Fly   363 QRVMANVRERQRTQSLNDAFKSLQQIIPTLPSD-KLSKIQTLKLATRYIDFLCRMLSSSDISLLK 426
            :::..|.|||.|.||:|:||..|:::|||.|.| ||||.:||:||.|||:||.::|....:. ..
Mouse     3 RKIFTNTRERWRQQSVNNAFAKLRKLIPTHPPDKKLSKNETLRLAMRYINFLVKVLGEQSLH-QT 66

  Fly   427 ALEAQGS 433
            .:.|||:
Mouse    67 GVAAQGN 73

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
twiNP_523816.2 bHLH_TS_TWIST 363..421 CDD:381470 30/58 (52%)
Tal2NP_033343.1 bHLH_SF 2..62 CDD:469605 30/58 (52%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 76..108
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.