DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment twi and Scx

DIOPT Version :9

Sequence 1:NP_001033967.1 Gene:twi / 37655 FlyBaseID:FBgn0003900 Length:490 Species:Drosophila melanogaster
Sequence 2:XP_006520723.1 Gene:Scx / 20289 MGIID:102934 Length:232 Species:Mus musculus


Alignment Length:195 Identity:61/195 - (31%)
Similarity:79/195 - (40%) Gaps:69/195 - (35%)


- Green bases have known domain annotations that are detailed below.


  Fly   285 GSAYSSSD---------RDDMEYARHNALSSVSDLNGGVMSPACLADDGSAGSLLDGSDAGGKAF 340
            ||..|.||         |..::.||..|        ||         ..:|||   |...||:..
Mouse    30 GSESSGSDEKPCRVHAARCGLQGARRRA--------GG---------RRAAGS---GPGPGGRPG 74

  Fly   341 RKPRRRLKRKPSKTEETDEFSNQRVMANVRERQRTQSLNDAFKSLQQIIPTLPSD-KLSKIQTLK 404
            |:||                  ||..||.|||.||.|:|.||.:|:.:|||.|:| |||||:||:
Mouse    75 REPR------------------QRHTANARERDRTNSVNTAFTALRTLIPTEPADRKLSKIETLR 121

  Fly   405 LATRYIDFLCRMLSSSDISLLKALEAQGSPSAYGSASSLLSAAANGAEADLKCLRKANGAPIIPP 469
            ||:.||..|      .::.|:......|.|...|.|......|               |:|:.||
Mouse   122 LASSYISHL------GNVLLVGEACGDGQPCHSGPAFFHSGRA---------------GSPLPPP 165

  Fly   470  469
            Mouse   166  165

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
twiNP_001033967.1 HLH 363..413 CDD:278439 30/50 (60%)
ScxXP_006520723.1 bHLH_TS_scleraxis 76..143 CDD:381521 34/90 (38%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C167839663
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.840

Return to query results.
Submit another query.