DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment twi and Neurod2

DIOPT Version :9

Sequence 1:NP_001033967.1 Gene:twi / 37655 FlyBaseID:FBgn0003900 Length:490 Species:Drosophila melanogaster
Sequence 2:NP_035025.3 Gene:Neurod2 / 18013 MGIID:107755 Length:383 Species:Mus musculus


Alignment Length:270 Identity:64/270 - (23%)
Similarity:95/270 - (35%) Gaps:95/270 - (35%)


- Green bases have known domain annotations that are detailed below.


  Fly   310 LNGGVMSP----ACLADDGSAGSL----------LDGSDAGGKAFRKPRRRLKRKPSKTEETDEF 360
            |.||...|    |.:.::|..|..          ||  :|.|:   :|::|..:|...|:...|.
Mouse    60 LRGGEEIPEPTLAEVKEEGELGGEEEEEEEEEEGLD--EAEGE---RPKKRGPKKRKMTKARLER 119

  Fly   361 SN-QRVMANVRERQRTQSLNDAFKSLQQIIPTL-PSDKLSKIQTLKLATRYI------------- 410
            |. :|..||.|||.|...||.|..:|::::|.. .:.|||||:||:||..||             
Mouse   120 SKLRRQKANARERNRMHDLNAALDNLRKVVPCYSKTQKLSKIETLRLAKNYIWALSEILRSGKRP 184

  Fly   411 ------DFLCRMLSSSDISLLKA---------LEAQGSPSA------------------------ 436
                  ..||:.||....:|:..         |..||:..|                        
Mouse   185 DLVSYVQTLCKGLSQPTTNLVAGCLQLNSRNFLTEQGADGAGRFHGSGGPFAMHPYPYPCSRLAG 249

  Fly   437 ---------------------YGSASSLLSAAANGAEADLKCLRKANGAPIIPPEKLSYLFGVWR 480
                                 |.:|...|.|||.|..|...........|:.||..|:..|.: :
Mouse   250 AQCQAAGGLGGGAAHALRTHGYCAAYETLYAAAGGGGASPDYNSSEYEGPLSPPLCLNGNFSL-K 313

  Fly   481 MEGDAQHQKA 490
            .:....|:|:
Mouse   314 QDSSPDHEKS 323

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
twiNP_001033967.1 HLH 363..413 CDD:278439 23/69 (33%)
Neurod2NP_035025.3 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..130 20/74 (27%)
bHLH_TS_NeuroD2 89..181 CDD:381563 33/96 (34%)
Nuclear localization signal. /evidence=ECO:0000255 108..114 1/5 (20%)
Neuro_bHLH 181..311 CDD:372170 21/129 (16%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.