DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment twi and hlh-3

DIOPT Version :10

Sequence 1:NP_523816.2 Gene:twi / 37655 FlyBaseID:FBgn0003900 Length:490 Species:Drosophila melanogaster
Sequence 2:NP_495938.4 Gene:hlh-3 / 174447 WormBaseID:WBGene00001950 Length:170 Species:Caenorhabditis elegans


Alignment Length:95 Identity:24/95 - (25%)
Similarity:33/95 - (34%) Gaps:23/95 - (24%)


- Green bases have known domain annotations that are detailed below.


  Fly   272 APKVAEQKEDIFSHGADGINRTLEDNQQQNEMQTREQKLTECFTKSIEELFHDKCRAESKLASHF 336
            ||.|....|.:|...|.||:...:..::           .|...|.|..:          :|..|
 Worm   398 APLVGIMSEKLFGFDAKGIDHVNDSGRE-----------AEALGKGIMWM----------MALPF 441

  Fly   337 IECQRLQTHLDVL--KSRLKDREEANREEE 364
            ..|....|.|..|  |.|..||..::||.|
 Worm   442 GLCCLCYTPLHFLFRKDRKIDRTTSSREVE 471

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
twiNP_523816.2 bHLH_TS_TWIST 363..421 CDD:381470 1/2 (50%)
hlh-3NP_495938.4 bHLH_TS_ASCL 28..83 CDD:381424
COG3416 <47..>136 CDD:442642
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.