DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment twi and Mesp1

DIOPT Version :9

Sequence 1:NP_001033967.1 Gene:twi / 37655 FlyBaseID:FBgn0003900 Length:490 Species:Drosophila melanogaster
Sequence 2:NP_032614.2 Gene:Mesp1 / 17292 MGIID:107785 Length:243 Species:Mus musculus


Alignment Length:139 Identity:47/139 - (33%)
Similarity:68/139 - (48%) Gaps:22/139 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly   308 SDLNGGVMSPACLADDGSAGSLLDGSDAGGKA--FRKPRRRLKRKPSK--TEETDEFSNQRVMAN 368
            ||.| .|.|||..:|.      .||:.|...|  ..:|.|| ...|.:  |..:...|.||..|:
Mouse    26 SDGN-SVCSPAWSSDP------WDGAQASSPAPPCARPARR-AGTPGRRGTHGSRLGSGQRQSAS 82

  Fly   369 VRERQRTQSLNDAFKSLQQIIPTLPS-----DKLSKIQTLKLATRYIDFLCRMLSSSDISLLK-- 426
            .||:.|.::|..|...|::.:|  ||     ..|:||:||:||.|||..|..:|..|:.:|.:  
Mouse    83 EREKLRMRTLARALHELRRFLP--PSVAPTGQNLTKIETLRLAIRYIGHLSAVLGLSEDNLRRQR 145

  Fly   427 -ALEAQGSP 434
             |:..:|.|
Mouse   146 HAVSPRGCP 154

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
twiNP_001033967.1 HLH 363..413 CDD:278439 22/54 (41%)
Mesp1NP_032614.2 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..86 22/67 (33%)
HLH 77..130 CDD:278439 22/54 (41%)
CPLCP 153..157 1/2 (50%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 204..228
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.