DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment twi and Twist2

DIOPT Version :9

Sequence 1:NP_001033967.1 Gene:twi / 37655 FlyBaseID:FBgn0003900 Length:490 Species:Drosophila melanogaster
Sequence 2:NP_031881.1 Gene:Twist2 / 13345 MGIID:104685 Length:160 Species:Mus musculus


Alignment Length:213 Identity:74/213 - (34%)
Similarity:98/213 - (46%) Gaps:67/213 - (31%)


- Green bases have known domain annotations that are detailed below.


  Fly   279 PANSLNGSAYSSSDRDDMEYARHNALSSVSDLNGGVMSPACLADDGSAGSLLDGSDAGGKAFRKP 343
            |.:|| |::....:|....:.|....|..|            ::|||.               .|
Mouse    11 PVDSL-GTSEEELERQPKRFGRKRRYSKKS------------SEDGSP---------------TP 47

  Fly   344 RRRLKRKPSKTEETDEFSNQRVMANVRERQRTQSLNDAFKSLQQIIPTLPSDKLSKIQTLKLATR 408
            .:|.|:.....:..:|..:||::|||||||||||||:||.:|::|||||||||||||||||||.|
Mouse    48 GKRGKKGSPSAQSFEELQSQRILANVRERQRTQSLNEAFAALRKIIPTLPSDKLSKIQTLKLAAR 112

  Fly   409 YIDFLCRMLSSSDISLLKALEAQGSPSAYGSASSLLSAAANGAEADLKCLRKANGAPIIPPEKLS 473
            |||||.::|.|.::.                                   .|......:..|:||
Mouse   113 YIDFLYQVLQSDEMD-----------------------------------NKMTSCSYVAHERLS 142

  Fly   474 YLFGVWRMEG----DAQH 487
            |.|.||||||    .|.|
Mouse   143 YAFSVWRMEGAWSMSASH 160

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
twiNP_001033967.1 HLH 363..413 CDD:278439 41/49 (84%)
Twist2NP_031881.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..63 14/79 (18%)
bHLH_TS_TWIST2 51..132 CDD:381543 48/115 (42%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C167839669
Domainoid 1 1.000 90 1.000 Domainoid score I7765
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0001055
OrthoInspector 1 1.000 - - otm43384
orthoMCL 1 0.900 - - OOG6_107717
Panther 1 1.100 - - LDO PTHR23349
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R5507
SonicParanoid 1 1.000 - - X1477
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
98.870

Return to query results.
Submit another query.