DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment twi and HLH54F

DIOPT Version :10

Sequence 1:NP_523816.2 Gene:twi / 37655 FlyBaseID:FBgn0003900 Length:490 Species:Drosophila melanogaster
Sequence 2:XP_308637.5 Gene:HLH54F / 1269982 VectorBaseID:AGAMI1_011263 Length:310 Species:Anopheles gambiae


Alignment Length:111 Identity:39/111 - (35%)
Similarity:57/111 - (51%) Gaps:18/111 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly   343 PRRRLKRKPSKTEE------TDEFSN---------QRVMANVRERQRTQSLNDAFKSLQQIIPTL 392
            |:|  |:.||...:      .|:||:         ||..||.|||.|.:.|:.||.:|::.||.:
Mosquito     2 PKR--KKAPSPKFDLLEDGFDDDFSSNDDKPGTPIQRNAANARERARMRVLSKAFFNLKRNIPWV 64

  Fly   393 PSD-KLSKIQTLKLATRYIDFLCRMLSSSDISLLKALEAQGSPSAY 437
            |:| ||||:.||:||..||.:|...|....:.......||...:|:
Mosquito    65 PADTKLSKLDTLRLAKNYITYLAATLDGQSVEDFSTNLAQPPKTAW 110

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
twiNP_523816.2 bHLH_TS_TWIST 363..421 CDD:381470 28/58 (48%)
HLH54FXP_308637.5 None

Return to query results.
Submit another query.