DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment twi and Neurog3

DIOPT Version :9

Sequence 1:NP_001033967.1 Gene:twi / 37655 FlyBaseID:FBgn0003900 Length:490 Species:Drosophila melanogaster
Sequence 2:NP_033849.3 Gene:Neurog3 / 11925 MGIID:893591 Length:214 Species:Mus musculus


Alignment Length:207 Identity:60/207 - (28%)
Similarity:84/207 - (40%) Gaps:41/207 - (19%)


- Green bases have known domain annotations that are detailed below.


  Fly   256 PHQQSHAQMHFQNAYRQSFEGYEPANSLNGSAYSSSDRDDMEYARHNALSSVSDLNGGVMSPACL 320
            ||......:......:|.|.|             :||        |..|||    |....||..:
Mouse     3 PHPLDALTIQVSPETQQPFPG-------------ASD--------HEVLSS----NSTPPSPTLI 42

  Fly   321 ADDGSAGSLLD--GSDAGGKAFRKPRRRLKRKPSKTEETDEFSNQRVMANVRERQRTQSLNDAFK 383
            ..|.|...:.|  |:....:|.|..|.|.|   |:...:.:..::|..||.|||.|..:||.|..
Mouse    43 PRDCSEAEVGDCRGTSRKLRARRGGRNRPK---SELALSKQRRSRRKKANDRERNRMHNLNSALD 104

  Fly   384 SLQQIIPTLPSD-KLSKIQTLKLATRYIDFLCRMLSSSDISLL----------KALEAQGSPSAY 437
            :|:.::||.|.| ||:||:||:.|..||..|.:.|..:|.|..          ......||...:
Mouse   105 ALRGVLPTFPDDAKLTKIETLRFAHNYIWALTQTLRIADHSFYGPEPPVPCGELGSPGGGSNGDW 169

  Fly   438 GSASSLLSAAAN 449
            ||..|.:|.|.|
Mouse   170 GSIYSPVSQAGN 181

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
twiNP_001033967.1 HLH 363..413 CDD:278439 24/50 (48%)
Neurog3NP_033849.3 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..98 31/122 (25%)
HLH 81..140 CDD:238036 25/58 (43%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.