DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment twi and LOC11175595

DIOPT Version :10

Sequence 1:NP_523816.2 Gene:twi / 37655 FlyBaseID:FBgn0003900 Length:490 Species:Drosophila melanogaster
Sequence 2:XP_003436908.1 Gene:LOC11175595 / 11175595 VectorBaseID:AGAMI1_008552 Length:129 Species:Anopheles gambiae


Alignment Length:57 Identity:32/57 - (56%)
Similarity:41/57 - (71%) Gaps:1/57 - (1%)


- Green bases have known domain annotations that are detailed below.


  Fly   362 NQRVMANVRERQRTQSLNDAFKSLQQIIPTLPSD-KLSKIQTLKLATRYIDFLCRML 417
            :||:.||.|||.||.|:|.||.:|:.:|||.|.| |||||:||:||..||..|..:|
Mosquito    24 DQRLQANARERYRTHSVNSAFNNLRLLIPTEPPDRKLSKIETLRLAKSYISHLIAVL 80

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
twiNP_523816.2 bHLH_TS_TWIST 363..421 CDD:381470 32/56 (57%)
LOC11175595XP_003436908.1 bHLH_SF 26..80 CDD:469605 30/53 (57%)

Return to query results.
Submit another query.