DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment twi and mespbb

DIOPT Version :9

Sequence 1:NP_001033967.1 Gene:twi / 37655 FlyBaseID:FBgn0003900 Length:490 Species:Drosophila melanogaster
Sequence 2:NP_001252536.1 Gene:mespbb / 100148845 ZFINID:ZDB-GENE-110609-1 Length:244 Species:Danio rerio


Alignment Length:221 Identity:58/221 - (26%)
Similarity:90/221 - (40%) Gaps:53/221 - (23%)


- Green bases have known domain annotations that are detailed below.


  Fly   281 NSLNGSAYSSSDRDDMEYARHNALSSVSDLNGGVMSPACLADDGSAGSLLDGS--DAGGKAFRKP 343
            |.:..:::||    |.|....::..:||..:....||:..|...|....:.||  ..||::....
Zfish     9 NYIQQNSWSS----DSELYNISSPETVSPSSYMDFSPSAQAQSVSPKPEISGSSFQDGGRSRVGV 69

  Fly   344 RRRLKRKPSKTEETDEFSNQRVMANVRERQRTQSLNDAFKSLQQIIPTLPS-----DKLSKIQTL 403
            ||...:.|||         ||..|:.:|:.|.:.|..|...|:..:|  ||     ..|:||:||
Zfish    70 RRTRCKNPSK---------QRQSASEKEKLRMRDLTKALHHLRTYLP--PSVAPVGQTLTKIETL 123

  Fly   404 KLATRYIDFLCRMLSSSDISLLK-------------------ALEAQGS-PSAYGSASSLLSAAA 448
            :|..|||.:|...|..|:.||.|                   ..|..|| .::.|::.|:|    
Zfish   124 RLTIRYISYLSAQLGLSEESLCKMRDLRVSGYQEMPQNHCYSTAEFWGSCQNSCGTSESVL---- 184

  Fly   449 NGAEADLKCLRKANGAPIIPPEKLSY 474
              ...|:.|.:...|.     ||.:|
Zfish   185 --RRTDMDCRQVFMGM-----EKPAY 203

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
twiNP_001033967.1 HLH 363..413 CDD:278439 20/54 (37%)
mespbbNP_001252536.1 HLH 80..133 CDD:278439 20/54 (37%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.