DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment twi and tcf21

DIOPT Version :9

Sequence 1:NP_001033967.1 Gene:twi / 37655 FlyBaseID:FBgn0003900 Length:490 Species:Drosophila melanogaster
Sequence 2:NP_001103518.1 Gene:tcf21 / 100126209 XenbaseID:XB-GENE-484805 Length:179 Species:Xenopus tropicalis


Alignment Length:139 Identity:42/139 - (30%)
Similarity:65/139 - (46%) Gaps:9/139 - (6%)


- Green bases have known domain annotations that are detailed below.


  Fly   285 GSAYSSSDRDDMEYARHNALSSVSDLNGGVMSPACLADDGSAGSLLD-GSDAGGKAFRKPRRRLK 348
            ||.....|..::|....:.:....:...|:.:     |.....|..| ||...|:.....||:..
 Frog     4 GSLSDVEDFQEVEMLECDGIKLDPNKEFGISN-----DSNEESSTCDNGSPKKGRGTSGKRRKAP 63

  Fly   349 RKPSKTEETDEFSN--QRVMANVRERQRTQSLNDAFKSLQQIIPTLPSD-KLSKIQTLKLATRYI 410
            .|.|.....::...  ||..||.|||.|.:.|:.||..|:..:|.:|.| ||||:.||:||:.||
 Frog    64 SKKSPLGNINQEGKQVQRNAANARERARMRVLSKAFSRLKTTLPWVPPDTKLSKLDTLRLASSYI 128

  Fly   411 DFLCRMLSS 419
            ..|.::|::
 Frog   129 AHLRQILAN 137

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
twiNP_001033967.1 HLH 363..413 CDD:278439 25/50 (50%)
tcf21NP_001103518.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 23..87 15/68 (22%)
bHLH_TS_TCF21_capsulin 77..140 CDD:381547 27/61 (44%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.