DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment twi and twist2

DIOPT Version :9

Sequence 1:NP_001033967.1 Gene:twi / 37655 FlyBaseID:FBgn0003900 Length:490 Species:Drosophila melanogaster
Sequence 2:NP_001096679.1 Gene:twist2 / 100125350 XenbaseID:XB-GENE-5878700 Length:162 Species:Xenopus tropicalis


Alignment Length:182 Identity:71/182 - (39%)
Similarity:88/182 - (48%) Gaps:57/182 - (31%)


- Green bases have known domain annotations that are detailed below.


  Fly   323 DGSAGSLLDGSDAGG----KAFRK-----------------PRRRLKRKPSKTEETDEFSNQRVM 366
            |...||::...:...    ||.||                 |.:|.||.| ..|..::...||::
 Frog     9 DSPEGSMVTSEEEADRQQRKAIRKRTILVGKPSEGRVPLSPPCKRNKRSP-HIETFEDVHTQRII 72

  Fly   367 ANVRERQRTQSLNDAFKSLQQIIPTLPSDKLSKIQTLKLATRYIDFLCRMLSSSDISLLKALEAQ 431
            ||||||||||||||||..|::|||||||||||||||||||:||||||.::|.|.::.        
 Frog    73 ANVRERQRTQSLNDAFAELRKIIPTLPSDKLSKIQTLKLASRYIDFLYQVLQSDELD-------- 129

  Fly   432 GSPSAYGSASSLLSAAANGAEADLKCLRKANGAPIIPPEKLSYLFGVWRMEG 483
                                       .|......:..|:|||.|.||||||
 Frog   130 ---------------------------HKIASCNYLAHERLSYAFSVWRMEG 154

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
twiNP_001033967.1 HLH 363..413 CDD:278439 42/49 (86%)
twist2NP_001096679.1 bHLH_SF 61..134 CDD:381792 48/107 (45%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 91 1.000 Domainoid score I7592
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 1 1.000 - - H101975
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0001055
OrthoInspector 1 1.000 - - otm48529
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X1477
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
66.000

Return to query results.
Submit another query.