DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment twi and neurod4

DIOPT Version :9

Sequence 1:NP_001033967.1 Gene:twi / 37655 FlyBaseID:FBgn0003900 Length:490 Species:Drosophila melanogaster
Sequence 2:NP_001124513.1 Gene:neurod4 / 100124310 XenbaseID:XB-GENE-972704 Length:316 Species:Xenopus tropicalis


Alignment Length:156 Identity:48/156 - (30%)
Similarity:74/156 - (47%) Gaps:30/156 - (19%)


- Green bases have known domain annotations that are detailed below.


  Fly   291 SDRDDMEYARHNALSSVSDLNGGVMSPACLADDGSAGSLLDGSDAGGKAFRKPRRRLKRKPSKTE 355
            |.:|:||   .|...|..|:..|:......:.||...   |..:..|:   ||::|..:|...|:
 Frog    16 SSQDEME---RNQRQSAYDIISGLSHEERCSIDGEDD---DEEEEDGE---KPKKRGPKKKKMTK 71

  Fly   356 -ETDEFSNQRVMANVRERQRTQSLNDAFKSLQQIIPTL-PSDKLSKIQTLKLATRYI-------- 410
             ..:.|..:||.||.|||.|...||||.::|::::|.. .:.|||||:||:||..||        
 Frog    72 ARLERFRVRRVKANARERTRMHGLNDALENLRRVMPCYSKTQKLSKIETLRLARNYIWALSDILE 136

  Fly   411 -----------DFLCRMLSSSDISLL 425
                       :.||:.||....:|:
 Frog   137 QGQSTEGKGFLEMLCKGLSQPTSNLV 162

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
twiNP_001033967.1 HLH 363..413 CDD:278439 25/69 (36%)
neurod4NP_001124513.1 bHLH_TS_NeuroD4_ATOH3 <69..137 CDD:381564 27/67 (40%)
Neuro_bHLH 138..256 CDD:372170 5/25 (20%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.