DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment twi and hand2

DIOPT Version :9

Sequence 1:NP_001033967.1 Gene:twi / 37655 FlyBaseID:FBgn0003900 Length:490 Species:Drosophila melanogaster
Sequence 2:NP_001093695.1 Gene:hand2 / 100101704 XenbaseID:XB-GENE-481426 Length:210 Species:Xenopus tropicalis


Alignment Length:170 Identity:55/170 - (32%)
Similarity:81/170 - (47%) Gaps:56/170 - (32%)


- Green bases have known domain annotations that are detailed below.


  Fly   262 AQMHFQNAYRQSFEGYEPAN-SLNGSAYSSSDRDDMEYARHNALSSVSDLNGGVMSPACLADDGS 325
            ::.|.:|.|   |.|:..:: .::...||.:.....|||                       :|:
 Frog    29 SRCHEENPY---FHGWLISHPEMSPPDYSMAPSYSPEYA-----------------------NGA 67

  Fly   326 AGSLLD--------GSDAGGKAFRKPRRRLKRKPSKTEETDEFSNQRVMANVRERQRTQSLNDAF 382
            ||  ||        ||.|||         |.::|.|         :|..||.:||:||||:|.||
 Frog    68 AG--LDHSHYGGVPGSGAGG---------LMQRPVK---------RRGTANRKERRRTQSINSAF 112

  Fly   383 KSLQQIIPTLPSD-KLSKIQTLKLATRYIDFLCRMLSSSD 421
            ..|::.||.:|:| |||||:||:|||.||.:|..:|:..|
 Frog   113 AELRECIPNVPADTKLSKIKTLRLATSYIAYLMDLLAKDD 152

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
twiNP_001033967.1 HLH 363..413 CDD:278439 29/50 (58%)
hand2NP_001093695.1 bHLH_TS_HAND2 93..154 CDD:381477 32/60 (53%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R5507
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
32.940

Return to query results.
Submit another query.