Sequence 1: | NP_001033967.1 | Gene: | twi / 37655 | FlyBaseID: | FBgn0003900 | Length: | 490 | Species: | Drosophila melanogaster |
---|---|---|---|---|---|---|---|---|---|
Sequence 2: | NP_001018632.1 | Gene: | olig1 / 100001484 | ZFINID: | ZDB-GENE-050107-2 | Length: | 235 | Species: | Danio rerio |
Alignment Length: | 207 | Identity: | 56/207 - (27%) |
---|---|---|---|
Similarity: | 78/207 - (37%) | Gaps: | 61/207 - (29%) |
- Green bases have known domain annotations that are detailed below.
Fly 300 RHNALSSVSDLNGGVMSPACLADDGSAGSLLDGSDAGGKAFRKPRRRLKRKPSKTEETDEFSNQR 364
Fly 365 VMANVRERQRTQSLNDAFKSLQQII--------------------PTLPSD--KLSKIQTLKLAT 407
Fly 408 RYIDFL-------CRMLSSSDI------SLLKALEAQGSPSAYGSASSLLSAAANGAEADL---K 456
Fly 457 CLRKANGAPIIP 468 |
Gene | Sequence | Domain | Region | External ID | Identity |
---|---|---|---|---|---|
twi | NP_001033967.1 | HLH | 363..413 | CDD:278439 | 23/71 (32%) |
olig1 | NP_001018632.1 | HLH domain | 62..139 | 24/76 (32%) | |
HLH | 62..133 | CDD:278439 | 23/70 (33%) |
Tool | Simple Score | Weighted Score | Original Tool Information | |||
---|---|---|---|---|---|---|
BLAST Result | Score | Score Type | Cluster ID | |||
Compara | 0 | 0.000 | Not matched by this tool. | |||
Domainoid | 0 | 0.000 | Not matched by this tool. | |||
eggNOG | 0 | 0.000 | Not matched by this tool. | |||
Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
Homologene | 0 | 0.000 | Not matched by this tool. | |||
Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
OMA | 0 | 0.000 | Not matched by this tool. | |||
OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
Panther | 0 | 0.000 | Not matched by this tool. | |||
Phylome | 1 | 0.910 | - | - | ||
RoundUp | 0 | 0.000 | Not matched by this tool. | |||
SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
TreeFam | 0 | 0.000 | Not matched by this tool. | |||
ZFIN | 0 | 0.000 | Not matched by this tool. | |||
1 | 0.910 |