DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment twi and olig1

DIOPT Version :9

Sequence 1:NP_001033967.1 Gene:twi / 37655 FlyBaseID:FBgn0003900 Length:490 Species:Drosophila melanogaster
Sequence 2:NP_001018632.1 Gene:olig1 / 100001484 ZFINID:ZDB-GENE-050107-2 Length:235 Species:Danio rerio


Alignment Length:207 Identity:56/207 - (27%)
Similarity:78/207 - (37%) Gaps:61/207 - (29%)


- Green bases have known domain annotations that are detailed below.


  Fly   300 RHNALSSVSDLNGGVMSPACLADDGSAGSLLDGSDAGGKAFRKPRRRLKRKPSKTEETDEFSNQR 364
            |....||:..|     .|..:...||.|   .||:.|  :.:.|.|  ..||.:...::|....|
Zfish    10 REQGESSLQQL-----MPRMVRVTGSGG---PGSNVG--SLQGPLR--SSKPPRELSSEEQQELR 62

  Fly   365 VMANVRERQRTQSLNDAFKSLQQII--------------------PTLPSD--KLSKIQTLKLAT 407
            ...|.|||:|.|.||.|..:|::::                    |..|:.  :||||.||.||.
Zfish    63 RKINSRERKRMQDLNVAMDALREVMVPYSSSPTGVGGALQHPYFPPGAPTTGRRLSKISTLVLAR 127

  Fly   408 RYIDFL-------CRMLSSSDI------SLLKALEAQGSPSAYGSASSLLSAAANGAEADL---K 456
            .||..|       .|:|....|      ::.:.|...|.|...|....|||.    .|..|   |
Zfish   128 NYILLLGSSLQEMRRLLGEVSIGMGVSGTVPRLLLTGGWPFLTGPGQLLLSP----PEQQLGVAK 188

  Fly   457 CLRKANGAPIIP 468
            |       |::|
Zfish   189 C-------PLLP 193

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
twiNP_001033967.1 HLH 363..413 CDD:278439 23/71 (32%)
olig1NP_001018632.1 HLH domain 62..139 24/76 (32%)
HLH 62..133 CDD:278439 23/70 (33%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.