DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG42741 and Klf7

DIOPT Version :9

Sequence 1:NP_611747.2 Gene:CG42741 / 37654 FlyBaseID:FBgn0261705 Length:362 Species:Drosophila melanogaster
Sequence 2:XP_006496414.1 Gene:Klf7 / 93691 MGIID:1935151 Length:302 Species:Mus musculus


Alignment Length:131 Identity:79/131 - (60%)
Similarity:91/131 - (69%) Gaps:10/131 - (7%)


- Green bases have known domain annotations that are detailed below.


  Fly   242 SSFSGINFGGGGSAFGFTTS-------SDSMANGGYNDL--SKNRKVHKCDTEGCDKVYTKSSHL 297
            :|.|.:..||..:|...|.:       |||...||..|.  ...::||:|...||.|||||||||
Mouse   171 ASLSSVKVGGVAAAAAVTPAGAVKSGQSDSEQGGGGADTCPENKKRVHRCQFNGCRKVYTKSSHL 235

  Fly   298 KAHKRTHTG-EKPYVCTWEGCIWRFARSDELTRHYRKHTGVKPFRCQLCTRSFSRSDHLSLHMRR 361
            |||:||||| ||||.|:||||.||||||||||||||||||.|||:|..|.|.|||||||:|||:|
Mouse   236 KAHQRTHTGSEKPYKCSWEGCEWRFARSDELTRHYRKHTGAKPFKCNHCDRCFSRSDHLALHMKR 300

  Fly   362 H 362
            |
Mouse   301 H 301

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG42741NP_611747.2 COG5048 <273..>352 CDD:227381 57/81 (70%)
zf-C2H2 280..304 CDD:278523 17/23 (74%)
C2H2 Zn finger 282..304 CDD:275368 16/21 (76%)
zf-H2C2_2 296..>313 CDD:290200 14/17 (82%)
C2H2 Zn finger 312..334 CDD:275368 19/21 (90%)
zf-H2C2_2 326..351 CDD:290200 18/24 (75%)
C2H2 Zn finger 342..362 CDD:275368 13/19 (68%)
Klf7XP_006496414.1 KLF7_N 2..219 CDD:409244 13/47 (28%)
COG5048 <223..>281 CDD:227381 49/57 (86%)
C2H2 Zn finger 223..242 CDD:275368 15/18 (83%)
C2H2 Zn finger 251..273 CDD:275368 19/21 (90%)
zf-H2C2_2 265..290 CDD:404364 18/24 (75%)
zf-C2H2 279..301 CDD:395048 14/21 (67%)
C2H2 Zn finger 281..301 CDD:275368 13/19 (68%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000436
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR23235
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
33.010

Return to query results.
Submit another query.