DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG42741 and KLF4

DIOPT Version :9

Sequence 1:NP_611747.2 Gene:CG42741 / 37654 FlyBaseID:FBgn0261705 Length:362 Species:Drosophila melanogaster
Sequence 2:NP_001300981.1 Gene:KLF4 / 9314 HGNCID:6348 Length:513 Species:Homo sapiens


Alignment Length:444 Identity:135/444 - (30%)
Similarity:172/444 - (38%) Gaps:105/444 - (23%)


- Green bases have known domain annotations that are detailed below.


  Fly     8 GSD--PLSAKEAE-----------------GPPVQVEPVDLSLRSPRASTSHGSSS-----SSYK 48
            ||:  ||..:|.|                 .||..|.....|..|..:|:|..||.     |:..
Human    85 GSNLAPLPRRETEEFNDLLDLDFILSNSLTHPPESVAATVSSSASASSSSSPSSSGPASAPSTCS 149

  Fly    49 FSSANKAVGYSNGKPGGSSGS-----------------------SSSSGFGAGSAGSSSLGAFAA 90
            |:...:|.......|||:.|.                       |.|.||.|..........:..
Human   150 FTYPIRAGNDPGVAPGGTGGGLLYGRESAPPPTAPFNLADINDVSPSGGFVAELLRPELDPVYIP 214

  Fly    91 QQQQQLYASSGVSKLPFSPFFAASPFFFTYRRISGSGSGNGTGSV-SVKQEDNNNS-----CSYN 149
            .||.|......:.|            |.....:|..||..|:.|| ||.:...:.|     ..||
Human   215 PQQPQPPGGGLMGK------------FVLKASLSAPGSEYGSPSVISVSKGSPDGSHPVVVAPYN 267

  Fly   150 NGSSSGGAGSAANSMQDYESKFSLLSL---FKNPYKFAGGD----GQASRKTSPTGGSSKPLASN 207
            .|...    :.....|:..|..:.|..   ..|.::.|..|    .|...:|:||.|..:.|:|.
Human   268 GGPPR----TCPKIKQEAVSSCTHLGAGPPLSNGHRPAAHDFPLGRQLPSRTTPTLGLEEVLSSR 328

  Fly   208 S-------SPSWKSYAGSGSPH---AALNPA-----FGGMGRG-ATRKDNSSFSGINFGGGGSAF 256
            .       .|.:..:.|...|.   ..:.|.     :.|..|| ..|.........:||..|...
Human   329 DCHPALPLPPGFHPHPGPNYPSFLPDQMQPQVPPLHYQGQSRGFVARAGEPCVCWPHFGTHGMML 393

  Fly   257 ------------GFTTSSDSMANGGYNDLSKNR-KVHKCDTEGCDKVYTKSSHLKAHKRTHTGEK 308
                        |.....:.....|.....:.| ..|.||..||.|.||||||||||.|||||||
Human   394 TPPSSPLELMPPGSCMPEEPKPKRGRRSWPRKRTATHTCDYAGCGKTYTKSSHLKAHLRTHTGEK 458

  Fly   309 PYVCTWEGCIWRFARSDELTRHYRKHTGVKPFRCQLCTRSFSRSDHLSLHMRRH 362
            ||.|.|:||.|:||||||||||||||||.:||:||.|.|:|||||||:|||:||
Human   459 PYHCDWDGCGWKFARSDELTRHYRKHTGHRPFQCQKCDRAFSRSDHLALHMKRH 512

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG42741NP_611747.2 COG5048 <273..>352 CDD:227381 55/79 (70%)
zf-C2H2 280..304 CDD:278523 17/23 (74%)
C2H2 Zn finger 282..304 CDD:275368 16/21 (76%)
zf-H2C2_2 296..>313 CDD:290200 14/16 (88%)
C2H2 Zn finger 312..334 CDD:275368 17/21 (81%)
zf-H2C2_2 326..351 CDD:290200 18/24 (75%)
C2H2 Zn finger 342..362 CDD:275368 14/19 (74%)
KLF4NP_001300981.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 22..45
9aaTAD. /evidence=ECO:0000269|PubMed:31375868 101..109 0/7 (0%)
Interaction with ZNF296. /evidence=ECO:0000250|UniProtKB:Q60793 416..513 66/97 (68%)
COG5048 <425..508 CDD:227381 60/82 (73%)
zf-C2H2 430..454 CDD:278523 17/23 (74%)
C2H2 Zn finger 432..454 CDD:275368 16/21 (76%)
C2H2 Zn finger 462..484 CDD:275368 17/21 (81%)
Interaction with target DNA. /evidence=ECO:0000250 473..504 24/30 (80%)
zf-H2C2_2 476..501 CDD:290200 18/24 (75%)
C2H2 Zn finger 492..512 CDD:275368 14/19 (74%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR23235
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
22.010

Return to query results.
Submit another query.