DRSC - DRSC Integrative Ortholog Prediction Tool

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits

Protein Alignment CG42741 and KLF7

DIOPT Version :9

Sequence 1:	NP_611747.2	Gene:	CG42741 / 37654	FlyBaseID:	FBgn0261705	Length:	362	Species:	Drosophila melanogaster
Sequence 2:	XP_005246983.1	Gene:	KLF7 / 8609	HGNCID:	6350	Length:	303	Species:	Homo sapiens

Alignment Length:	132	Identity:	76/132 - (57%)
Similarity:	93/132 - (70%)	Gaps:	11/132 - (8%)

- Green bases have known domain annotations that are detailed below.

  Fly   242 SSFSGINFGGGGSAFGFTTSSDSMANG---------GYNDLSKNRK-VHKCDTEGCDKVYTKSSH 296
            ::.|.:..||..:|....|::.::.:|         |.....:|:| ||:|...||.||||||||
Human   171 AALSSVKVGGVATAAAAVTAAGAVKSGQSDSDQGGLGAEACPENKKRVHRCQFNGCRKVYTKSSH 235

  Fly   297 LKAHKRTHTG-EKPYVCTWEGCIWRFARSDELTRHYRKHTGVKPFRCQLCTRSFSRSDHLSLHMR 360
            ||||:||||| ||||.|:||||.||||||||||||||||||.|||:|..|.|.|||||||:|||:
Human   236 LKAHQRTHTGSEKPYKCSWEGCEWRFARSDELTRHYRKHTGAKPFKCNHCDRCFSRSDHLALHMK 300

  Fly   361 RH 362
            ||
Human   301 RH 302

Known Domains:

Indicated by green bases in alignment.

Gene	Sequence	Domain	Region	External ID	Identity
CG42741	NP_611747.2	COG5048	<273..>352	CDD:227381	59/80 (74%)
		zf-C2H2	280..304	CDD:278523	17/23 (74%)
		C2H2 Zn finger	282..304	CDD:275368	16/21 (76%)
		zf-H2C2_2	296..>313	CDD:290200	14/17 (82%)
		C2H2 Zn finger	312..334	CDD:275368	19/21 (90%)
		zf-H2C2_2	326..351	CDD:290200	18/24 (75%)
		C2H2 Zn finger	342..362	CDD:275368	13/19 (68%)
KLF7	XP_005246983.1	KLF7_N	2..220	CDD:409244	10/48 (21%)
		COG5048	<224..>282	CDD:227381	49/57 (86%)
		C2H2 Zn finger	224..243	CDD:275368	15/18 (83%)
		C2H2 Zn finger	252..274	CDD:275368	19/21 (90%)
		zf-H2C2_2	266..291	CDD:404364	18/24 (75%)
		zf-C2H2	280..302	CDD:395048	14/21 (67%)
		C2H2 Zn finger	282..302	CDD:275368	13/19 (68%)

Information from Original Tools:

Tool	Simple Score	Weighted Score	Original Tool Information
Tool	Simple Score	Weighted Score	BLAST Result	Score	Score Type	Cluster ID
Compara	0	0.000	Not matched by this tool.
Domainoid	0	0.000	Not matched by this tool.
eggNOG	0	0.000	Not matched by this tool.
Hieranoid	0	0.000	Not matched by this tool.
Homologene	0	0.000	Not matched by this tool.
Inparanoid	0	0.000	Not matched by this tool.
Isobase	0	0.000	Not matched by this tool.
OMA	0	0.000	Not matched by this tool.
OrthoDB	1	1.010	-	-		D416605at33208
OrthoFinder	1	1.000	-	-		FOG0000436
OrthoInspector	0	0.000	Not matched by this tool.
orthoMCL	0	0.000	Not matched by this tool.
Panther	1	1.100	-	-	O	PTHR23235
Phylome	1	0.910	-	-
RoundUp	0	0.000	Not matched by this tool.
SonicParanoid	0	0.000	Not matched by this tool.
SwiftOrtho	0	0.000	Not matched by this tool.
TreeFam	0	0.000	Not matched by this tool.
User_Submission	0	0.000	Not matched by this tool.
	4	4.020