DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG42741 and COM2

DIOPT Version :9

Sequence 1:NP_611747.2 Gene:CG42741 / 37654 FlyBaseID:FBgn0261705 Length:362 Species:Drosophila melanogaster
Sequence 2:NP_011056.1 Gene:COM2 / 856867 SGDID:S000000932 Length:443 Species:Saccharomyces cerevisiae


Alignment Length:242 Identity:67/242 - (27%)
Similarity:95/242 - (39%) Gaps:37/242 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly   144 NSCSYNNGSSSGGAGSAANSMQDYESKFSLLSLFKNPYKFAGGDGQASRKTSPTGGSSKPLASNS 208
            :|.|.||.|:|.|    ...:|...|  |...:|||  :|.........|:.|....::.|.::.
Yeast   213 SSSSSNNNSNSLG----CEPIQTENS--SSQKMFKN--RFFRSRKSTLIKSLPLEQENEVLINSG 269

  Fly   209 SPSWKSYAGSGSPHAALNPAFGGMGRGATRKDNSSFS---GINFGGGGSAFGFTTSSDSMANGGY 270
            .....:.....|.||.:||    :......||.|:.|   ..|....||.|.........:|...
Yeast   270 FDVSSNEESDESDHAIINP----LKLVGNNKDISTQSIAKTTNPFKSGSDFKMIEPVSKFSNDSR 330

  Fly   271 NDL----SKNRKVHKCDTEGCDKVYTKSSH-LKAHKRTHT-----GEKP---------YVCTWEG 316
            .||    |:................:.||| |...|:|.:     |.||         :.|  |.
Yeast   331 KDLLAAISEPSSSPSPSAPSPSVQSSSSSHGLVVRKKTGSMQKTRGRKPSLIPDASKQFGC--EF 393

  Fly   317 CIWRFARSDELTRHYRK-HTGVKPFRCQLCTRSFSRSDHLSLHMRRH 362
            |..||.|.:.|.||.|. |...|||.|.:|.::|||||:|:.|::.|
Yeast   394 CDRRFKRQEHLKRHVRSLHMCEKPFTCHICNKNFSRSDNLNQHVKTH 440

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG42741NP_611747.2 COG5048 <273..>352 CDD:227381 29/98 (30%)
zf-C2H2 280..304 CDD:278523 5/24 (21%)
C2H2 Zn finger 282..304 CDD:275368 5/22 (23%)
zf-H2C2_2 296..>313 CDD:290200 7/31 (23%)
C2H2 Zn finger 312..334 CDD:275368 10/22 (45%)
zf-H2C2_2 326..351 CDD:290200 11/25 (44%)
C2H2 Zn finger 342..362 CDD:275368 9/19 (47%)
COM2NP_011056.1 COG5048 1..443 CDD:227381 67/242 (28%)
C2H2 Zn finger 391..412 CDD:275368 10/22 (45%)
C2H2 Zn finger 420..440 CDD:275368 9/19 (47%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 51 1.000 Inparanoid score I1832
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.050

Return to query results.
Submit another query.