Sequence 1: | NP_611747.2 | Gene: | CG42741 / 37654 | FlyBaseID: | FBgn0261705 | Length: | 362 | Species: | Drosophila melanogaster |
---|---|---|---|---|---|---|---|---|---|
Sequence 2: | NP_112397.1 | Gene: | Klf10 / 81813 | RGDID: | 621652 | Length: | 480 | Species: | Rattus norvegicus |
Alignment Length: | 232 | Identity: | 85/232 - (36%) |
---|---|---|---|
Similarity: | 105/232 - (45%) | Gaps: | 56/232 - (24%) |
- Green bases have known domain annotations that are detailed below.
Fly 180 PYKFAGGDGQA--------------------SRKTSPTGG--------SSKPLASNSS------P 210
Fly 211 SWKSYAGSGSPHAALNPA-FGG--MGRG------------ATRKDNSSFSGINFGGGGSAFGFTT 260
Fly 261 SSDSMANGGYNDLSKNRKVHKCDTEGCDKVYTKSSHLKAHKRTHTGEKPYVCTWEGCIWRFARSD 325
Fly 326 ELTRHYRKHTGVKPFRCQLCTRSFSRSDHLSLHMRRH 362 |
Gene | Sequence | Domain | Region | External ID | Identity |
---|---|---|---|---|---|
CG42741 | NP_611747.2 | COG5048 | <273..>352 | CDD:227381 | 48/78 (62%) |
zf-C2H2 | 280..304 | CDD:278523 | 15/23 (65%) | ||
C2H2 Zn finger | 282..304 | CDD:275368 | 14/21 (67%) | ||
zf-H2C2_2 | 296..>313 | CDD:290200 | 13/16 (81%) | ||
C2H2 Zn finger | 312..334 | CDD:275368 | 15/21 (71%) | ||
zf-H2C2_2 | 326..351 | CDD:290200 | 14/24 (58%) | ||
C2H2 Zn finger | 342..362 | CDD:275368 | 11/19 (58%) | ||
Klf10 | NP_112397.1 | Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite | 1..32 | ||
KLF10_N | 33..369 | CDD:409241 | 30/148 (20%) | ||
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite | 64..83 | ||||
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite | 97..146 | ||||
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite | 202..222 | ||||
zf-C2H2 | 369..393 | CDD:395048 | 15/23 (65%) | ||
C2H2 Zn finger | 374..393 | CDD:275368 | 13/18 (72%) | ||
zf-H2C2_2 | 385..412 | CDD:404364 | 19/26 (73%) | ||
C2H2 Zn finger | 401..423 | CDD:275368 | 15/21 (71%) | ||
zf-C2H2 | 429..451 | CDD:395048 | 12/21 (57%) | ||
C2H2 Zn finger | 431..451 | CDD:275368 | 11/19 (58%) | ||
Blue background indicates that the domain is not in the aligned region. |
Tool | Simple Score | Weighted Score | Original Tool Information | |||
---|---|---|---|---|---|---|
BLAST Result | Score | Score Type | Cluster ID | |||
Compara | 0 | 0.000 | Not matched by this tool. | |||
Domainoid | 0 | 0.000 | Not matched by this tool. | |||
eggNOG | 0 | 0.000 | Not matched by this tool. | |||
Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
Homologene | 0 | 0.000 | Not matched by this tool. | |||
Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
OMA | 0 | 0.000 | Not matched by this tool. | |||
OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
Panther | 1 | 1.100 | - | - | O | PTHR23235 |
Phylome | 1 | 0.910 | - | - | ||
SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
SwiftOrtho | 1 | 1.000 | - | - | ||
TreeFam | 0 | 0.000 | Not matched by this tool. | |||
3 | 3.010 |